Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY343233.1 | internal | 249 | 2-748(+) |
Amino Acid sequence : | |||
RERERERERETYDSILRDVRPPVTSYAPNIWADTFSNISLDEEVQKKYAETIEALKQVVRGMLMAAATPIKQMIFIDTLERLGLAYHFETEIEHKLQKIYDDNVCGDDCDLFTTALRFRL LRQHRHHVSCDVFDKFLYEEGKFKGDAEGLLSLYEASHVRFHNEKILEEAERFTRQELSCMESKLQSPLKDKVKRALERPLHREVPILYARHFISIYEKDESMDEHLLKLAKFNFNFLQN LYKRELYDL | |||
Physicochemical properties | |||
Number of amino acids: | 249 | ||
Molecular weight: | 29,711.520 | ||
Theoretical pI: | 5.861 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 21890 22140 | ||
Instability index: | 52.819 | ||
aromaticity | 0.104 | ||
GRAVY | -0.607 | ||
Secondary Structure Fraction | |||
Helix | 0.321 | ||
turn | 0.129 | ||
sheet | 0.317 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY343233.1 | internal | 249 | 2-748(+) |
Amino Acid sequence : | |||
RERERERERETYDSILRDVRPPVTSYAPNIWADTFSNISLDEEVQKKYAETIEALKQVVRGMLMAAATPIKQMIFIDTLERLGLAYHFETEIEHKLQKIYDDNVCGDDCDLFTTALRFRL LRQHRHHVSCDVFDKFLYEEGKFKGDAEGLLSLYEASHVRFHNEKILEEAERFTRQELSCMESKLQSPLKDKVKRALERPLHREVPILYARHFISIYEKDESMDEHLLKLAKFNFNFLQN LYKRELYDL | |||
Physicochemical properties | |||
Number of amino acids: | 249 | ||
Molecular weight: | 29,711.520 | ||
Theoretical pI: | 5.861 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 21890 22140 | ||
Instability index: | 52.819 | ||
aromaticity | 0.104 | ||
GRAVY | -0.607 | ||
Secondary Structure Fraction | |||
Helix | 0.321 | ||
turn | 0.129 | ||
sheet | 0.317 |