Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY343245.1 | 5prime_partial | 111 | 1-336(+) |
Amino Acid sequence : | |||
RWMVVVRLARFGCIHAAVLLHPGPVTEEQINDVKCPIAMLGAETDNLAPPEMLEKLGKILKEKSEVDSMVKIFPGVGHGWSIRYEDDDEFAVKSAQESHGDMMNWLAKYIK* | |||
Physicochemical properties | |||
Number of amino acids: | 111 | ||
Molecular weight: | 12,478.372 | ||
Theoretical pI: | 5.516 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19480 19605 | ||
Instability index: | 33.902 | ||
aromaticity | 0.072 | ||
GRAVY | -0.159 | ||
Secondary Structure Fraction | |||
Helix | 0.306 | ||
turn | 0.198 | ||
sheet | 0.306 |