| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343245.1 | 5prime_partial | 111 | 1-336(+) |
Amino Acid sequence : | |||
| RWMVVVRLARFGCIHAAVLLHPGPVTEEQINDVKCPIAMLGAETDNLAPPEMLEKLGKILKEKSEVDSMVKIFPGVGHGWSIRYEDDDEFAVKSAQESHGDMMNWLAKYIK* | |||
Physicochemical properties | |||
| Number of amino acids: | 111 | ||
| Molecular weight: | 12,478.372 | ||
| Theoretical pI: | 5.516 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19480 19605 | ||
| Instability index: | 33.902 | ||
| aromaticity | 0.072 | ||
| GRAVY | -0.159 | ||
Secondary Structure Fraction | |||
| Helix | 0.306 | ||
| turn | 0.198 | ||
| sheet | 0.306 | ||