| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343248.1 | 3prime_partial | 256 | 57-824(+) |
Amino Acid sequence : | |||
| MAAAALVSNGDYAAVKAPVTGRLASVYSEVQNSRLEHSLPLPSVLKSSFKVVDGPPSSAAGNPDEIAKLFPCLFGQPSASLVPGDSAGALSSQALKIGVVLSGGQAPGGHNVISGIFDYL QDHCKGSTLYGFRGGPAGIMKGKYVVLTPEYIYPYRNQGGFDMICSGRDKIETPEQFKQAEETAVKLDLDGIVVIGGDDSNTNACLLAENFRSKNLKTRVIGCPKTIDGDLKSKEVPISF GFDTACKIYAEMIGNV | |||
Physicochemical properties | |||
| Number of amino acids: | 256 | ||
| Molecular weight: | 11,165.187 | ||
| Theoretical pI: | 10.453 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7115 | ||
| Instability index: | 62.629 | ||
| aromaticity | 0.108 | ||
| GRAVY | 0.702 | ||
Secondary Structure Fraction | |||
| Helix | 0.392 | ||
| turn | 0.324 | ||
| sheet | 0.235 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343248.1 | complete | 102 | 826-518(-) |
Amino Acid sequence : | |||
| MTLPIISAYILHAVSNPKLMGTSLLFRSPSMVFGHPITLVFKFLLLKFSARRHAFVFESSPPITTIPSRSSFTAVSSACLNCSGVSILSLPLQIISNPPWFL* | |||
Physicochemical properties | |||
| Number of amino acids: | 102 | ||
| Molecular weight: | 11,165.187 | ||
| Theoretical pI: | 10.453 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7115 | ||
| Instability index: | 62.629 | ||
| aromaticity | 0.108 | ||
| GRAVY | 0.702 | ||
Secondary Structure Fraction | |||
| Helix | 0.392 | ||
| turn | 0.324 | ||
| sheet | 0.235 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343248.1 | 3prime_partial | 256 | 57-824(+) |
Amino Acid sequence : | |||
| MAAAALVSNGDYAAVKAPVTGRLASVYSEVQNSRLEHSLPLPSVLKSSFKVVDGPPSSAAGNPDEIAKLFPCLFGQPSASLVPGDSAGALSSQALKIGVVLSGGQAPGGHNVISGIFDYL QDHCKGSTLYGFRGGPAGIMKGKYVVLTPEYIYPYRNQGGFDMICSGRDKIETPEQFKQAEETAVKLDLDGIVVIGGDDSNTNACLLAENFRSKNLKTRVIGCPKTIDGDLKSKEVPISF GFDTACKIYAEMIGNV | |||
Physicochemical properties | |||
| Number of amino acids: | 256 | ||
| Molecular weight: | 11,165.187 | ||
| Theoretical pI: | 10.453 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7115 | ||
| Instability index: | 62.629 | ||
| aromaticity | 0.108 | ||
| GRAVY | 0.702 | ||
Secondary Structure Fraction | |||
| Helix | 0.392 | ||
| turn | 0.324 | ||
| sheet | 0.235 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343248.1 | complete | 102 | 826-518(-) |
Amino Acid sequence : | |||
| MTLPIISAYILHAVSNPKLMGTSLLFRSPSMVFGHPITLVFKFLLLKFSARRHAFVFESSPPITTIPSRSSFTAVSSACLNCSGVSILSLPLQIISNPPWFL* | |||
Physicochemical properties | |||
| Number of amino acids: | 102 | ||
| Molecular weight: | 11,165.187 | ||
| Theoretical pI: | 10.453 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7115 | ||
| Instability index: | 62.629 | ||
| aromaticity | 0.108 | ||
| GRAVY | 0.702 | ||
Secondary Structure Fraction | |||
| Helix | 0.392 | ||
| turn | 0.324 | ||
| sheet | 0.235 | ||