| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343251.1 | 5prime_partial | 171 | 2-517(+) |
Amino Acid sequence : | |||
| RSGFPHIAAMVLKTELCRFSGAKIYPGKGIRFIRSDSQVFLFANSKCKRYFHNRLRPAKLTWTAMYRKQHKKDIAAEAVKKRRRATKKPYSRSIVGATLEVIQKNRSEKQEVRDAAREAA LREIKERIKKTKDEKKAKKAETMSKQKTAKSSAPKGAMPKGPKIGGGGGKR* | |||
Physicochemical properties | |||
| Number of amino acids: | 171 | ||
| Molecular weight: | 17,891.245 | ||
| Theoretical pI: | 10.349 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 27960 28210 | ||
| Instability index: | 44.091 | ||
| aromaticity | 0.158 | ||
| GRAVY | 0.783 | ||
Secondary Structure Fraction | |||
| Helix | 0.437 | ||
| turn | 0.184 | ||
| sheet | 0.335 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343251.1 | 3prime_partial | 158 | 474-1(-) |
Amino Acid sequence : | |||
| MAPFGALLLAVFCLDIVSAFLAFFSSLVFLILSLISRKAASRAASRTSCFSLLFFWITSNVAPTMDLEYGFFVALRLFFTASAAISFLCCFRYIAVQVSLAGLRRLWKYLLHFELAKRKT WESERINLIPFPGYILAPLKRQSSVLRTMAAIWGKPLR | |||
Physicochemical properties | |||
| Number of amino acids: | 158 | ||
| Molecular weight: | 17,891.245 | ||
| Theoretical pI: | 10.349 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 27960 28210 | ||
| Instability index: | 44.091 | ||
| aromaticity | 0.158 | ||
| GRAVY | 0.783 | ||
Secondary Structure Fraction | |||
| Helix | 0.437 | ||
| turn | 0.184 | ||
| sheet | 0.335 | ||