| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343255.1 | internal | 258 | 2-775(+) |
Amino Acid sequence : | |||
| FSLFKHSQTYSFRSTQKGSERVREREMASCGALRTAFLPSLLHSHRTTAALPTKPQKFSVGAALQHDNTNDISSVASQEPKPLTFTGEKPSTPILDTINFPNHMKNLSIEELEKLCDELR EEIVYTVSKTGGHLSSSLGVSELTVALHHVFNTPDDKIIWDVGHQAYPHKILTGRRSKMHTIRQTFGLAGFPKRDESPHDAFGAGHSSTSISAGLGMAVGRDLLNKNNHVISVIGDGAMT AGQAYEALNNAGFLDANL | |||
Physicochemical properties | |||
| Number of amino acids: | 258 | ||
| Molecular weight: | 28,118.305 | ||
| Theoretical pI: | 7.398 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11585 | ||
| Instability index: | 40.839 | ||
| aromaticity | 0.066 | ||
| GRAVY | -0.377 | ||
Secondary Structure Fraction | |||
| Helix | 0.256 | ||
| turn | 0.271 | ||
| sheet | 0.252 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343255.1 | internal | 258 | 2-775(+) |
Amino Acid sequence : | |||
| FSLFKHSQTYSFRSTQKGSERVREREMASCGALRTAFLPSLLHSHRTTAALPTKPQKFSVGAALQHDNTNDISSVASQEPKPLTFTGEKPSTPILDTINFPNHMKNLSIEELEKLCDELR EEIVYTVSKTGGHLSSSLGVSELTVALHHVFNTPDDKIIWDVGHQAYPHKILTGRRSKMHTIRQTFGLAGFPKRDESPHDAFGAGHSSTSISAGLGMAVGRDLLNKNNHVISVIGDGAMT AGQAYEALNNAGFLDANL | |||
Physicochemical properties | |||
| Number of amino acids: | 258 | ||
| Molecular weight: | 28,118.305 | ||
| Theoretical pI: | 7.398 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11585 | ||
| Instability index: | 40.839 | ||
| aromaticity | 0.066 | ||
| GRAVY | -0.377 | ||
Secondary Structure Fraction | |||
| Helix | 0.256 | ||
| turn | 0.271 | ||
| sheet | 0.252 | ||