| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343258.1 | internal | 245 | 2-736(+) |
Amino Acid sequence : | |||
| IYRLPKLPPNLASSLSFVKISLPKLPELPENADATTDLERADQMDALKRAFDGLESGLAHFLEESKPDWIIYDFAPHWLPPITARLGIHGAFFFIINAWFLAFYGPVRHLINGSDYRSKA EDFMVPPKWVDFDTKVAFRRFEAEWMVSSVHNSGSGYSDIQRAGHVIAGTEAVVIKHSFEFEPEWLSVLEKLHGKPVIPVGLMALERDGVEGGGNESWDKIRKWLENQEKGSVVYVALGS EVTPS | |||
Physicochemical properties | |||
| Number of amino acids: | 245 | ||
| Molecular weight: | 27,537.025 | ||
| Theoretical pI: | 5.395 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 52940 52940 | ||
| Instability index: | 31.580 | ||
| aromaticity | 0.118 | ||
| GRAVY | -0.167 | ||
Secondary Structure Fraction | |||
| Helix | 0.343 | ||
| turn | 0.249 | ||
| sheet | 0.273 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343258.1 | internal | 245 | 2-736(+) |
Amino Acid sequence : | |||
| IYRLPKLPPNLASSLSFVKISLPKLPELPENADATTDLERADQMDALKRAFDGLESGLAHFLEESKPDWIIYDFAPHWLPPITARLGIHGAFFFIINAWFLAFYGPVRHLINGSDYRSKA EDFMVPPKWVDFDTKVAFRRFEAEWMVSSVHNSGSGYSDIQRAGHVIAGTEAVVIKHSFEFEPEWLSVLEKLHGKPVIPVGLMALERDGVEGGGNESWDKIRKWLENQEKGSVVYVALGS EVTPS | |||
Physicochemical properties | |||
| Number of amino acids: | 245 | ||
| Molecular weight: | 27,537.025 | ||
| Theoretical pI: | 5.395 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 52940 52940 | ||
| Instability index: | 31.580 | ||
| aromaticity | 0.118 | ||
| GRAVY | -0.167 | ||
Secondary Structure Fraction | |||
| Helix | 0.343 | ||
| turn | 0.249 | ||
| sheet | 0.273 | ||