| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343264.1 | internal | 260 | 3-782(+) |
Amino Acid sequence : | |||
| FSSLPPTNFKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE GIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQ IFVKTLTGKTITLEVESSDT | |||
Physicochemical properties | |||
| Number of amino acids: | 260 | ||
| Molecular weight: | 19,572.075 | ||
| Theoretical pI: | 4.871 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
| Instability index: | 17.045 | ||
| aromaticity | 0.016 | ||
| GRAVY | 0.018 | ||
Secondary Structure Fraction | |||
| Helix | 0.341 | ||
| turn | 0.205 | ||
| sheet | 0.351 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343264.1 | 5prime_partial | 185 | 782-225(-) |
Amino Acid sequence : | |||
| GIRALHLQGDGLPRQSLDKNLHASSQPQHQVKGRLLLDVVVRQRAAVLELLAGKDQPLLIRGNALLVLDLGLDIVDGVRALNLKGDGLAGEGLDEDLHATTETEDKVEGGLLLDVIVSKG AAVLELLAGKDKPLLVRGNAFLVLNFRLDIVNGVGALDLQGDGFAGEGLHEDLHTTAKTEDQVEG* | |||
Physicochemical properties | |||
| Number of amino acids: | 185 | ||
| Molecular weight: | 19,572.075 | ||
| Theoretical pI: | 4.871 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
| Instability index: | 17.045 | ||
| aromaticity | 0.016 | ||
| GRAVY | 0.018 | ||
Secondary Structure Fraction | |||
| Helix | 0.341 | ||
| turn | 0.205 | ||
| sheet | 0.351 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343264.1 | internal | 260 | 3-782(+) |
Amino Acid sequence : | |||
| FSSLPPTNFKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE GIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQ IFVKTLTGKTITLEVESSDT | |||
Physicochemical properties | |||
| Number of amino acids: | 260 | ||
| Molecular weight: | 19,572.075 | ||
| Theoretical pI: | 4.871 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
| Instability index: | 17.045 | ||
| aromaticity | 0.016 | ||
| GRAVY | 0.018 | ||
Secondary Structure Fraction | |||
| Helix | 0.341 | ||
| turn | 0.205 | ||
| sheet | 0.351 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343264.1 | 5prime_partial | 185 | 782-225(-) |
Amino Acid sequence : | |||
| GIRALHLQGDGLPRQSLDKNLHASSQPQHQVKGRLLLDVVVRQRAAVLELLAGKDQPLLIRGNALLVLDLGLDIVDGVRALNLKGDGLAGEGLDEDLHATTETEDKVEGGLLLDVIVSKG AAVLELLAGKDKPLLVRGNAFLVLNFRLDIVNGVGALDLQGDGFAGEGLHEDLHTTAKTEDQVEG* | |||
Physicochemical properties | |||
| Number of amino acids: | 185 | ||
| Molecular weight: | 19,572.075 | ||
| Theoretical pI: | 4.871 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
| Instability index: | 17.045 | ||
| aromaticity | 0.016 | ||
| GRAVY | 0.018 | ||
Secondary Structure Fraction | |||
| Helix | 0.341 | ||
| turn | 0.205 | ||
| sheet | 0.351 | ||