Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY343264.1 | internal | 260 | 3-782(+) |
Amino Acid sequence : | |||
FSSLPPTNFKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE GIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQ IFVKTLTGKTITLEVESSDT | |||
Physicochemical properties | |||
Number of amino acids: | 260 | ||
Molecular weight: | 19,572.075 | ||
Theoretical pI: | 4.871 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
Instability index: | 17.045 | ||
aromaticity | 0.016 | ||
GRAVY | 0.018 | ||
Secondary Structure Fraction | |||
Helix | 0.341 | ||
turn | 0.205 | ||
sheet | 0.351 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY343264.1 | 5prime_partial | 185 | 782-225(-) |
Amino Acid sequence : | |||
GIRALHLQGDGLPRQSLDKNLHASSQPQHQVKGRLLLDVVVRQRAAVLELLAGKDQPLLIRGNALLVLDLGLDIVDGVRALNLKGDGLAGEGLDEDLHATTETEDKVEGGLLLDVIVSKG AAVLELLAGKDKPLLVRGNAFLVLNFRLDIVNGVGALDLQGDGFAGEGLHEDLHTTAKTEDQVEG* | |||
Physicochemical properties | |||
Number of amino acids: | 185 | ||
Molecular weight: | 19,572.075 | ||
Theoretical pI: | 4.871 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
Instability index: | 17.045 | ||
aromaticity | 0.016 | ||
GRAVY | 0.018 | ||
Secondary Structure Fraction | |||
Helix | 0.341 | ||
turn | 0.205 | ||
sheet | 0.351 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY343264.1 | internal | 260 | 3-782(+) |
Amino Acid sequence : | |||
FSSLPPTNFKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE GIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQ IFVKTLTGKTITLEVESSDT | |||
Physicochemical properties | |||
Number of amino acids: | 260 | ||
Molecular weight: | 19,572.075 | ||
Theoretical pI: | 4.871 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
Instability index: | 17.045 | ||
aromaticity | 0.016 | ||
GRAVY | 0.018 | ||
Secondary Structure Fraction | |||
Helix | 0.341 | ||
turn | 0.205 | ||
sheet | 0.351 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY343264.1 | 5prime_partial | 185 | 782-225(-) |
Amino Acid sequence : | |||
GIRALHLQGDGLPRQSLDKNLHASSQPQHQVKGRLLLDVVVRQRAAVLELLAGKDQPLLIRGNALLVLDLGLDIVDGVRALNLKGDGLAGEGLDEDLHATTETEDKVEGGLLLDVIVSKG AAVLELLAGKDKPLLVRGNAFLVLNFRLDIVNGVGALDLQGDGFAGEGLHEDLHTTAKTEDQVEG* | |||
Physicochemical properties | |||
Number of amino acids: | 185 | ||
Molecular weight: | 19,572.075 | ||
Theoretical pI: | 4.871 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
Instability index: | 17.045 | ||
aromaticity | 0.016 | ||
GRAVY | 0.018 | ||
Secondary Structure Fraction | |||
Helix | 0.341 | ||
turn | 0.205 | ||
sheet | 0.351 |