Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY343283.1 | internal | 253 | 1-759(+) |
Amino Acid sequence : | |||
SKGKSNHFVGSQDLGFRRDHMEVLSPMKDGILVDWDMVENIWDHALRKCLLIDPKEHPMLFAEPCSNSQQQREKTAEILFEKYQVPALFLAKNAVLTSFASGRATSLVVDCGGGSTTVAP VHDGYVLQKAVSTSPIGGEFLSDCLLKSLENKGIPIKPRYAFKRKEVRPGEFQVVDLDFPNTTESYKLYSQRVIVSDIKECVCRAPDTAYDDTSYSNIPMTPYELPDGQTIEIGANRFKI PDILFNPSLSLTI | |||
Physicochemical properties | |||
Number of amino acids: | 253 | ||
Molecular weight: | 28,236.921 | ||
Theoretical pI: | 5.596 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22920 23295 | ||
Instability index: | 33.637 | ||
aromaticity | 0.087 | ||
GRAVY | -0.268 | ||
Secondary Structure Fraction | |||
Helix | 0.308 | ||
turn | 0.245 | ||
sheet | 0.225 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY343283.1 | internal | 253 | 1-759(+) |
Amino Acid sequence : | |||
SKGKSNHFVGSQDLGFRRDHMEVLSPMKDGILVDWDMVENIWDHALRKCLLIDPKEHPMLFAEPCSNSQQQREKTAEILFEKYQVPALFLAKNAVLTSFASGRATSLVVDCGGGSTTVAP VHDGYVLQKAVSTSPIGGEFLSDCLLKSLENKGIPIKPRYAFKRKEVRPGEFQVVDLDFPNTTESYKLYSQRVIVSDIKECVCRAPDTAYDDTSYSNIPMTPYELPDGQTIEIGANRFKI PDILFNPSLSLTI | |||
Physicochemical properties | |||
Number of amino acids: | 253 | ||
Molecular weight: | 28,236.921 | ||
Theoretical pI: | 5.596 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22920 23295 | ||
Instability index: | 33.637 | ||
aromaticity | 0.087 | ||
GRAVY | -0.268 | ||
Secondary Structure Fraction | |||
Helix | 0.308 | ||
turn | 0.245 | ||
sheet | 0.225 |