| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343288.1 | 5prime_partial | 237 | 3-716(+) |
Amino Acid sequence : | |||
| GAIKSAVADGVVTFLWIFCASSLGALTYVVSSAVGIAPGLPALVITTFLIFTLLFVFGFIGDLLGGASFNPTATAAFYAAGLGGADSLLSAAIRFPAQAAGAVGGVLAISEVMPSQYKHM LGGPSLKVDTQTGAIAEGVLTFVITFAVLFIVIKGPRSSIVKNWLLSMSTVSLIVAGSSYTGPSMNPANAFGWAYVNNRHDTWEHFYVYWISPFVGAILAAWVFRFLFPPPTKEKKA* | |||
Physicochemical properties | |||
| Number of amino acids: | 237 | ||
| Molecular weight: | 24,852.715 | ||
| Theoretical pI: | 9.046 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 43430 43430 | ||
| Instability index: | 29.456 | ||
| aromaticity | 0.135 | ||
| GRAVY | 0.783 | ||
Secondary Structure Fraction | |||
| Helix | 0.397 | ||
| turn | 0.266 | ||
| sheet | 0.270 | ||