Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY343288.1 | 5prime_partial | 237 | 3-716(+) |
Amino Acid sequence : | |||
GAIKSAVADGVVTFLWIFCASSLGALTYVVSSAVGIAPGLPALVITTFLIFTLLFVFGFIGDLLGGASFNPTATAAFYAAGLGGADSLLSAAIRFPAQAAGAVGGVLAISEVMPSQYKHM LGGPSLKVDTQTGAIAEGVLTFVITFAVLFIVIKGPRSSIVKNWLLSMSTVSLIVAGSSYTGPSMNPANAFGWAYVNNRHDTWEHFYVYWISPFVGAILAAWVFRFLFPPPTKEKKA* | |||
Physicochemical properties | |||
Number of amino acids: | 237 | ||
Molecular weight: | 24,852.715 | ||
Theoretical pI: | 9.046 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 43430 43430 | ||
Instability index: | 29.456 | ||
aromaticity | 0.135 | ||
GRAVY | 0.783 | ||
Secondary Structure Fraction | |||
Helix | 0.397 | ||
turn | 0.266 | ||
sheet | 0.270 |