Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY343293.1 | internal | 244 | 2-733(+) |
Amino Acid sequence : | |||
DSYCLEIQKNQKTEGGCDSCHQCDYEIEYADHSSSIGVLARDDLALNIANGSLAKPKVVFGCAYDQQGLLLNTLGKTDGILGLSRAKISLPSQLASQGIIRNVVGHCLATDTDGGGYLFF GDDFVPQWKMAWVPMLQSLDSYSYKAEIMKVDYGSRQIGLDDLKGRQSRVIFDTGSSYSYFTEEAYNNLVAMLKVISSESLVLDTSDTSLPICWRSKSPLRSVKDVRMLFKPLILQFRSK WWIL | |||
Physicochemical properties | |||
Number of amino acids: | 244 | ||
Molecular weight: | 27,181.713 | ||
Theoretical pI: | 5.650 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 43890 44265 | ||
Instability index: | 53.927 | ||
aromaticity | 0.098 | ||
GRAVY | -0.139 | ||
Secondary Structure Fraction | |||
Helix | 0.336 | ||
turn | 0.246 | ||
sheet | 0.225 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY343293.1 | internal | 244 | 2-733(+) |
Amino Acid sequence : | |||
DSYCLEIQKNQKTEGGCDSCHQCDYEIEYADHSSSIGVLARDDLALNIANGSLAKPKVVFGCAYDQQGLLLNTLGKTDGILGLSRAKISLPSQLASQGIIRNVVGHCLATDTDGGGYLFF GDDFVPQWKMAWVPMLQSLDSYSYKAEIMKVDYGSRQIGLDDLKGRQSRVIFDTGSSYSYFTEEAYNNLVAMLKVISSESLVLDTSDTSLPICWRSKSPLRSVKDVRMLFKPLILQFRSK WWIL | |||
Physicochemical properties | |||
Number of amino acids: | 244 | ||
Molecular weight: | 27,181.713 | ||
Theoretical pI: | 5.650 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 43890 44265 | ||
Instability index: | 53.927 | ||
aromaticity | 0.098 | ||
GRAVY | -0.139 | ||
Secondary Structure Fraction | |||
Helix | 0.336 | ||
turn | 0.246 | ||
sheet | 0.225 |