| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343293.1 | internal | 244 | 2-733(+) |
Amino Acid sequence : | |||
| DSYCLEIQKNQKTEGGCDSCHQCDYEIEYADHSSSIGVLARDDLALNIANGSLAKPKVVFGCAYDQQGLLLNTLGKTDGILGLSRAKISLPSQLASQGIIRNVVGHCLATDTDGGGYLFF GDDFVPQWKMAWVPMLQSLDSYSYKAEIMKVDYGSRQIGLDDLKGRQSRVIFDTGSSYSYFTEEAYNNLVAMLKVISSESLVLDTSDTSLPICWRSKSPLRSVKDVRMLFKPLILQFRSK WWIL | |||
Physicochemical properties | |||
| Number of amino acids: | 244 | ||
| Molecular weight: | 27,181.713 | ||
| Theoretical pI: | 5.650 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 43890 44265 | ||
| Instability index: | 53.927 | ||
| aromaticity | 0.098 | ||
| GRAVY | -0.139 | ||
Secondary Structure Fraction | |||
| Helix | 0.336 | ||
| turn | 0.246 | ||
| sheet | 0.225 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343293.1 | internal | 244 | 2-733(+) |
Amino Acid sequence : | |||
| DSYCLEIQKNQKTEGGCDSCHQCDYEIEYADHSSSIGVLARDDLALNIANGSLAKPKVVFGCAYDQQGLLLNTLGKTDGILGLSRAKISLPSQLASQGIIRNVVGHCLATDTDGGGYLFF GDDFVPQWKMAWVPMLQSLDSYSYKAEIMKVDYGSRQIGLDDLKGRQSRVIFDTGSSYSYFTEEAYNNLVAMLKVISSESLVLDTSDTSLPICWRSKSPLRSVKDVRMLFKPLILQFRSK WWIL | |||
Physicochemical properties | |||
| Number of amino acids: | 244 | ||
| Molecular weight: | 27,181.713 | ||
| Theoretical pI: | 5.650 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 43890 44265 | ||
| Instability index: | 53.927 | ||
| aromaticity | 0.098 | ||
| GRAVY | -0.139 | ||
Secondary Structure Fraction | |||
| Helix | 0.336 | ||
| turn | 0.246 | ||
| sheet | 0.225 | ||