| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343294.1 | 5prime_partial | 181 | 798-253(-) |
Amino Acid sequence : | |||
| KAEIMKVDYGSRQIGLDDLKGRQSRVIFDTGSSYSYFTEEAYNNLVAMLKVISSESLVLDTSDTSLPICWRSKSPLRSVKDVRMLFKPLILQFRSKWWILSRKLQIPPEGYLVINSKGNV CLGILNGRNVHDGSTFILGDISLRGLLFAYDNVNERIGWVRSDCSKPTTFQKHSTNPVLGL* | |||
Physicochemical properties | |||
| Number of amino acids: | 181 | ||
| Molecular weight: | 16,356.939 | ||
| Theoretical pI: | 9.173 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19940 20315 | ||
| Instability index: | 70.829 | ||
| aromaticity | 0.119 | ||
| GRAVY | -0.010 | ||
Secondary Structure Fraction | |||
| Helix | 0.336 | ||
| turn | 0.287 | ||
| sheet | 0.182 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343294.1 | complete | 143 | 38-469(+) |
Amino Acid sequence : | |||
| MITILCTYIYIPSLFLLYNKHTCTNNYSSSNKISNVSPHAACCSHTKRNGVELSGQWPIYKQKMVFFMLFLCHNPSTGFVECFWNVVGFEQSDRTHPILSFTLSYANSRPRSDMSPSIKV DPSCTFLPLRMPKHTLPLLLITK* | |||
Physicochemical properties | |||
| Number of amino acids: | 143 | ||
| Molecular weight: | 16,356.939 | ||
| Theoretical pI: | 9.173 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19940 20315 | ||
| Instability index: | 70.829 | ||
| aromaticity | 0.119 | ||
| GRAVY | -0.010 | ||
Secondary Structure Fraction | |||
| Helix | 0.336 | ||
| turn | 0.287 | ||
| sheet | 0.182 | ||