Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY343294.1 | 5prime_partial | 181 | 798-253(-) |
Amino Acid sequence : | |||
KAEIMKVDYGSRQIGLDDLKGRQSRVIFDTGSSYSYFTEEAYNNLVAMLKVISSESLVLDTSDTSLPICWRSKSPLRSVKDVRMLFKPLILQFRSKWWILSRKLQIPPEGYLVINSKGNV CLGILNGRNVHDGSTFILGDISLRGLLFAYDNVNERIGWVRSDCSKPTTFQKHSTNPVLGL* | |||
Physicochemical properties | |||
Number of amino acids: | 181 | ||
Molecular weight: | 16,356.939 | ||
Theoretical pI: | 9.173 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19940 20315 | ||
Instability index: | 70.829 | ||
aromaticity | 0.119 | ||
GRAVY | -0.010 | ||
Secondary Structure Fraction | |||
Helix | 0.336 | ||
turn | 0.287 | ||
sheet | 0.182 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY343294.1 | complete | 143 | 38-469(+) |
Amino Acid sequence : | |||
MITILCTYIYIPSLFLLYNKHTCTNNYSSSNKISNVSPHAACCSHTKRNGVELSGQWPIYKQKMVFFMLFLCHNPSTGFVECFWNVVGFEQSDRTHPILSFTLSYANSRPRSDMSPSIKV DPSCTFLPLRMPKHTLPLLLITK* | |||
Physicochemical properties | |||
Number of amino acids: | 143 | ||
Molecular weight: | 16,356.939 | ||
Theoretical pI: | 9.173 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19940 20315 | ||
Instability index: | 70.829 | ||
aromaticity | 0.119 | ||
GRAVY | -0.010 | ||
Secondary Structure Fraction | |||
Helix | 0.336 | ||
turn | 0.287 | ||
sheet | 0.182 |