| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343297.1 | 5prime_partial | 163 | 3-494(+) |
Amino Acid sequence : | |||
| RIREGPYVEDINIMANCLMLLSAHHGGVGRAGGEISRVFECKTCNRQFPSFQALGGHRASHKKPRLSAAGDDLQPPEASPRKPKTHECAICGLEFPIGQALGGHMRRHRSADQKRLASPE LSLSPPIVKKSNSRRVFSVDLNLTPSENKFMFGNVVPAVDCFF* | |||
Physicochemical properties | |||
| Number of amino acids: | 163 | ||
| Molecular weight: | 17,904.388 | ||
| Theoretical pI: | 9.501 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1865 | ||
| Instability index: | 60.071 | ||
| aromaticity | 0.061 | ||
| GRAVY | -0.406 | ||
Secondary Structure Fraction | |||
| Helix | 0.239 | ||
| turn | 0.294 | ||
| sheet | 0.239 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343297.1 | 5prime_partial | 163 | 3-494(+) |
Amino Acid sequence : | |||
| RIREGPYVEDINIMANCLMLLSAHHGGVGRAGGEISRVFECKTCNRQFPSFQALGGHRASHKKPRLSAAGDDLQPPEASPRKPKTHECAICGLEFPIGQALGGHMRRHRSADQKRLASPE LSLSPPIVKKSNSRRVFSVDLNLTPSENKFMFGNVVPAVDCFF* | |||
Physicochemical properties | |||
| Number of amino acids: | 163 | ||
| Molecular weight: | 17,904.388 | ||
| Theoretical pI: | 9.501 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1865 | ||
| Instability index: | 60.071 | ||
| aromaticity | 0.061 | ||
| GRAVY | -0.406 | ||
Secondary Structure Fraction | |||
| Helix | 0.239 | ||
| turn | 0.294 | ||
| sheet | 0.239 | ||