| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343307.1 | internal | 249 | 2-748(+) |
Amino Acid sequence : | |||
| RKHVSPLTQPFPRPALSVSPTPHNHDDWAETLRAHKLTQVTLFQKPLVKVKLVDLLAATNNFSRENVVVSSRTGTTYKAVLPDGSALAIKRLIECKMGEKQFRMEINRLGQLRHPNLVPL LGFCLVEDEKLLVYKHLSNGTLESMLASNAGELDWSTRFRIALGAARGLAWLHHGCHPPILHQNISSSVVMLDEDFDARITDFGLARLLNSSESNESSFVYGDLGEVGYVAPEYSSTMVA SHKGDAYSF | |||
Physicochemical properties | |||
| Number of amino acids: | 249 | ||
| Molecular weight: | 12,825.519 | ||
| Theoretical pI: | 9.036 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 33460 33585 | ||
| Instability index: | 69.450 | ||
| aromaticity | 0.113 | ||
| GRAVY | -0.177 | ||
Secondary Structure Fraction | |||
| Helix | 0.304 | ||
| turn | 0.304 | ||
| sheet | 0.270 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343307.1 | 5prime_partial | 115 | 747-400(-) |
Amino Acid sequence : | |||
| KLYASPLWEATIVLEYSGATYPTSPKSPYTKLLSFDSDEFRSLARPKSVIRASKSSSSMTTLELMFWCKIGGWQPWWSHASPLAAPNAILNRVDQSSSPALLANIDSRVPFERCL* | |||
Physicochemical properties | |||
| Number of amino acids: | 115 | ||
| Molecular weight: | 12,825.519 | ||
| Theoretical pI: | 9.036 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 33460 33585 | ||
| Instability index: | 69.450 | ||
| aromaticity | 0.113 | ||
| GRAVY | -0.177 | ||
Secondary Structure Fraction | |||
| Helix | 0.304 | ||
| turn | 0.304 | ||
| sheet | 0.270 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343307.1 | internal | 249 | 2-748(+) |
Amino Acid sequence : | |||
| RKHVSPLTQPFPRPALSVSPTPHNHDDWAETLRAHKLTQVTLFQKPLVKVKLVDLLAATNNFSRENVVVSSRTGTTYKAVLPDGSALAIKRLIECKMGEKQFRMEINRLGQLRHPNLVPL LGFCLVEDEKLLVYKHLSNGTLESMLASNAGELDWSTRFRIALGAARGLAWLHHGCHPPILHQNISSSVVMLDEDFDARITDFGLARLLNSSESNESSFVYGDLGEVGYVAPEYSSTMVA SHKGDAYSF | |||
Physicochemical properties | |||
| Number of amino acids: | 249 | ||
| Molecular weight: | 12,825.519 | ||
| Theoretical pI: | 9.036 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 33460 33585 | ||
| Instability index: | 69.450 | ||
| aromaticity | 0.113 | ||
| GRAVY | -0.177 | ||
Secondary Structure Fraction | |||
| Helix | 0.304 | ||
| turn | 0.304 | ||
| sheet | 0.270 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343307.1 | 5prime_partial | 115 | 747-400(-) |
Amino Acid sequence : | |||
| KLYASPLWEATIVLEYSGATYPTSPKSPYTKLLSFDSDEFRSLARPKSVIRASKSSSSMTTLELMFWCKIGGWQPWWSHASPLAAPNAILNRVDQSSSPALLANIDSRVPFERCL* | |||
Physicochemical properties | |||
| Number of amino acids: | 115 | ||
| Molecular weight: | 12,825.519 | ||
| Theoretical pI: | 9.036 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 33460 33585 | ||
| Instability index: | 69.450 | ||
| aromaticity | 0.113 | ||
| GRAVY | -0.177 | ||
Secondary Structure Fraction | |||
| Helix | 0.304 | ||
| turn | 0.304 | ||
| sheet | 0.270 | ||