Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY343308.1 | 5prime_partial | 127 | 1-384(+) |
Amino Acid sequence : | |||
KLEDAPHTKVGLVPRRADLDMNQHVNNVTYIGWVLESMPQEIIDSHELQTLTLDYRRECQQDDVVDSLTSPEPAMDENGSLQGTNGSPNAAKDENGSLQFLHLLRLAKDGSEINRGRTEW RKKPAKR* | |||
Physicochemical properties | |||
Number of amino acids: | 127 | ||
Molecular weight: | 14,347.809 | ||
Theoretical pI: | 5.328 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 13980 | ||
Instability index: | 55.344 | ||
aromaticity | 0.039 | ||
GRAVY | -0.886 | ||
Secondary Structure Fraction | |||
Helix | 0.236 | ||
turn | 0.244 | ||
sheet | 0.268 |