| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343333.1 | internal | 178 | 1-534(+) |
Amino Acid sequence : | |||
| SKLRGRNFLQPPGPLPVPIFGNWLQVGDDLNHRNLTDYAKRFGEIFLLRMGQRNLVVVSSPEHAKEVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFTVYGEHWRKMRRIMTVPFFTNKVV QQYRFRWEAEAAAVVDDVKRNPESATNGIVLRRRLPADDVQQYVPDYVPKTDSRPRMI | |||
Physicochemical properties | |||
| Number of amino acids: | 178 | ||
| Molecular weight: | 17,174.486 | ||
| Theoretical pI: | 6.616 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15470 | ||
| Instability index: | 83.357 | ||
| aromaticity | 0.034 | ||
| GRAVY | -0.339 | ||
Secondary Structure Fraction | |||
| Helix | 0.351 | ||
| turn | 0.203 | ||
| sheet | 0.304 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343333.1 | 5prime_partial | 148 | 534-88(-) |
Amino Acid sequence : | |||
| DHPRSRIGLWNIIRYILLYIISWQAPPQHDSVRRRLRIPLHIIHHGGSLRLPSEPVLLHHLVGEERHRHDPPHLPPVLAVDGEHHVLPLASENVEHNIARARSELHPLRVEHLLRVLRRR DDDEVALPHAEEEYLAESLRVIGEIAVV* | |||
Physicochemical properties | |||
| Number of amino acids: | 148 | ||
| Molecular weight: | 17,174.486 | ||
| Theoretical pI: | 6.616 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15470 | ||
| Instability index: | 83.357 | ||
| aromaticity | 0.034 | ||
| GRAVY | -0.339 | ||
Secondary Structure Fraction | |||
| Helix | 0.351 | ||
| turn | 0.203 | ||
| sheet | 0.304 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343333.1 | internal | 178 | 1-534(+) |
Amino Acid sequence : | |||
| SKLRGRNFLQPPGPLPVPIFGNWLQVGDDLNHRNLTDYAKRFGEIFLLRMGQRNLVVVSSPEHAKEVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFTVYGEHWRKMRRIMTVPFFTNKVV QQYRFRWEAEAAAVVDDVKRNPESATNGIVLRRRLPADDVQQYVPDYVPKTDSRPRMI | |||
Physicochemical properties | |||
| Number of amino acids: | 178 | ||
| Molecular weight: | 17,174.486 | ||
| Theoretical pI: | 6.616 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15470 | ||
| Instability index: | 83.357 | ||
| aromaticity | 0.034 | ||
| GRAVY | -0.339 | ||
Secondary Structure Fraction | |||
| Helix | 0.351 | ||
| turn | 0.203 | ||
| sheet | 0.304 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343333.1 | 5prime_partial | 148 | 534-88(-) |
Amino Acid sequence : | |||
| DHPRSRIGLWNIIRYILLYIISWQAPPQHDSVRRRLRIPLHIIHHGGSLRLPSEPVLLHHLVGEERHRHDPPHLPPVLAVDGEHHVLPLASENVEHNIARARSELHPLRVEHLLRVLRRR DDDEVALPHAEEEYLAESLRVIGEIAVV* | |||
Physicochemical properties | |||
| Number of amino acids: | 148 | ||
| Molecular weight: | 17,174.486 | ||
| Theoretical pI: | 6.616 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15470 | ||
| Instability index: | 83.357 | ||
| aromaticity | 0.034 | ||
| GRAVY | -0.339 | ||
Secondary Structure Fraction | |||
| Helix | 0.351 | ||
| turn | 0.203 | ||
| sheet | 0.304 | ||