| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343339.1 | internal | 253 | 1-759(+) |
Amino Acid sequence : | |||
| FGEHGPFQPSGNVLVKNDYSWNKVANMLYLESPAGVGFSYSANKSFYESVNDEMTARDNLVFLKNWMEKFPEFKNRKFYISGESYGGHYVPQLANLILESKSNINLTGIAIGNPLLEFTT DFNSRAEFLWSHGLISDSTYFEFTYSCNYSQIRRQAASGVLTPVCRRVIQLVSSEMSRFVDAYDVILDVCLSSVEQQSVVMNQMQDEPKVNVCVEDETVAYFNRKDVQSAFHARLVNVTS WSVCSEVLRYDMQ | |||
Physicochemical properties | |||
| Number of amino acids: | 253 | ||
| Molecular weight: | 28,854.122 | ||
| Theoretical pI: | 5.062 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 41370 41620 | ||
| Instability index: | 49.796 | ||
| aromaticity | 0.130 | ||
| GRAVY | -0.232 | ||
Secondary Structure Fraction | |||
| Helix | 0.344 | ||
| turn | 0.265 | ||
| sheet | 0.221 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343339.1 | internal | 253 | 1-759(+) |
Amino Acid sequence : | |||
| FGEHGPFQPSGNVLVKNDYSWNKVANMLYLESPAGVGFSYSANKSFYESVNDEMTARDNLVFLKNWMEKFPEFKNRKFYISGESYGGHYVPQLANLILESKSNINLTGIAIGNPLLEFTT DFNSRAEFLWSHGLISDSTYFEFTYSCNYSQIRRQAASGVLTPVCRRVIQLVSSEMSRFVDAYDVILDVCLSSVEQQSVVMNQMQDEPKVNVCVEDETVAYFNRKDVQSAFHARLVNVTS WSVCSEVLRYDMQ | |||
Physicochemical properties | |||
| Number of amino acids: | 253 | ||
| Molecular weight: | 28,854.122 | ||
| Theoretical pI: | 5.062 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 41370 41620 | ||
| Instability index: | 49.796 | ||
| aromaticity | 0.130 | ||
| GRAVY | -0.232 | ||
Secondary Structure Fraction | |||
| Helix | 0.344 | ||
| turn | 0.265 | ||
| sheet | 0.221 | ||