Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY343346.1 | internal | 253 | 1-759(+) |
Amino Acid sequence : | |||
ILIVTQACYVGKVRDYASENGVKVVCVDSPAPEDCVQFSDLISGDEHDLPAVEFSPDDVVALPYSSGTTGLPKGVMLTHKGLVTSVAQQVDGENPNLYIHSDDVIICVLPFFHIYSLNSI LLCGLRAGAAILLIQKFDIAPFLELIQRYKVTIGPFVPPMVLAIAKSPVVDKYDLSSVRTVMSGAAPLGKELEEAVRNKFPNAKLGQGYGMTEAGPVLAMCLAFAKEPFEIKSGSCGTVV RNAQMKIVDPETA | |||
Physicochemical properties | |||
Number of amino acids: | 253 | ||
Molecular weight: | 27,101.162 | ||
Theoretical pI: | 5.002 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11920 12295 | ||
Instability index: | 39.743 | ||
aromaticity | 0.071 | ||
GRAVY | 0.274 | ||
Secondary Structure Fraction | |||
Helix | 0.344 | ||
turn | 0.241 | ||
sheet | 0.257 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY343346.1 | internal | 253 | 1-759(+) |
Amino Acid sequence : | |||
ILIVTQACYVGKVRDYASENGVKVVCVDSPAPEDCVQFSDLISGDEHDLPAVEFSPDDVVALPYSSGTTGLPKGVMLTHKGLVTSVAQQVDGENPNLYIHSDDVIICVLPFFHIYSLNSI LLCGLRAGAAILLIQKFDIAPFLELIQRYKVTIGPFVPPMVLAIAKSPVVDKYDLSSVRTVMSGAAPLGKELEEAVRNKFPNAKLGQGYGMTEAGPVLAMCLAFAKEPFEIKSGSCGTVV RNAQMKIVDPETA | |||
Physicochemical properties | |||
Number of amino acids: | 253 | ||
Molecular weight: | 27,101.162 | ||
Theoretical pI: | 5.002 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11920 12295 | ||
Instability index: | 39.743 | ||
aromaticity | 0.071 | ||
GRAVY | 0.274 | ||
Secondary Structure Fraction | |||
Helix | 0.344 | ||
turn | 0.241 | ||
sheet | 0.257 |