Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY343348.1 | 3prime_partial | 224 | 58-729(+) |
Amino Acid sequence : | |||
MAQVAVNPEEEVVLSEEVGHVRVITLNQPRRLNVISHEVVELLARLLEKWEKDDDAELILIKGSGRAFSAGGDLKMFYDGRMSKDSNLEVVYRMYWLCYHIHTYKKTQVALVHGISMGGG ASLMVPMKFSVVTEKTVFATPEAGIGFHTDCGFSYLLSHLPGHLGEFLALTGARLNGAELVSAGFATHFVPSEKFPELQNRLISLNSGEAHAVKSAIEEFSTTV | |||
Physicochemical properties | |||
Number of amino acids: | 224 | ||
Molecular weight: | 24,663.011 | ||
Theoretical pI: | 5.793 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19940 20065 | ||
Instability index: | 35.018 | ||
aromaticity | 0.085 | ||
GRAVY | 0.050 | ||
Secondary Structure Fraction | |||
Helix | 0.335 | ||
turn | 0.223 | ||
sheet | 0.313 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY343348.1 | 3prime_partial | 224 | 58-729(+) |
Amino Acid sequence : | |||
MAQVAVNPEEEVVLSEEVGHVRVITLNQPRRLNVISHEVVELLARLLEKWEKDDDAELILIKGSGRAFSAGGDLKMFYDGRMSKDSNLEVVYRMYWLCYHIHTYKKTQVALVHGISMGGG ASLMVPMKFSVVTEKTVFATPEAGIGFHTDCGFSYLLSHLPGHLGEFLALTGARLNGAELVSAGFATHFVPSEKFPELQNRLISLNSGEAHAVKSAIEEFSTTV | |||
Physicochemical properties | |||
Number of amino acids: | 224 | ||
Molecular weight: | 24,663.011 | ||
Theoretical pI: | 5.793 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19940 20065 | ||
Instability index: | 35.018 | ||
aromaticity | 0.085 | ||
GRAVY | 0.050 | ||
Secondary Structure Fraction | |||
Helix | 0.335 | ||
turn | 0.223 | ||
sheet | 0.313 |