| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343360.1 | internal | 225 | 2-676(+) |
Amino Acid sequence : | |||
| KHKISCALNNIIDAQMKGEISEANVLYIVENINVAAIETTLWSMEWAIAELANHPTIQQKIRDEISAVLGKQSVTESNLLQLPYLQATINETLRLHSPIPLLVPHMNQEEATLGGYTIPK ESKVVVNAWWLSNNPEWWKNPEEFRPERFMEEDSGTEAAVAGGKVDFRFLPFGMGRRSCPGIILALPILGLIIARLVSNFEIMPPAGLREVDVSEKGGQFSLHIA | |||
Physicochemical properties | |||
| Number of amino acids: | 225 | ||
| Molecular weight: | 11,512.162 | ||
| Theoretical pI: | 10.852 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 125 | ||
| Instability index: | 37.950 | ||
| aromaticity | 0.064 | ||
| GRAVY | 0.062 | ||
Secondary Structure Fraction | |||
| Helix | 0.257 | ||
| turn | 0.385 | ||
| sheet | 0.229 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343360.1 | 5prime_partial | 109 | 675-346(-) |
Amino Acid sequence : | |||
| AMCRLNCPPFSLTSTSLNPAGGIISKFETSLAMIRPRMGSARIIPGQLLLPIPNGKNLKSTLPPATAASVPLSSSMNRSGRNSSGFFHHSGLLDSHHAFTTTFDSFGIV* | |||
Physicochemical properties | |||
| Number of amino acids: | 109 | ||
| Molecular weight: | 11,512.162 | ||
| Theoretical pI: | 10.852 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 125 | ||
| Instability index: | 37.950 | ||
| aromaticity | 0.064 | ||
| GRAVY | 0.062 | ||
Secondary Structure Fraction | |||
| Helix | 0.257 | ||
| turn | 0.385 | ||
| sheet | 0.229 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343360.1 | internal | 225 | 2-676(+) |
Amino Acid sequence : | |||
| KHKISCALNNIIDAQMKGEISEANVLYIVENINVAAIETTLWSMEWAIAELANHPTIQQKIRDEISAVLGKQSVTESNLLQLPYLQATINETLRLHSPIPLLVPHMNQEEATLGGYTIPK ESKVVVNAWWLSNNPEWWKNPEEFRPERFMEEDSGTEAAVAGGKVDFRFLPFGMGRRSCPGIILALPILGLIIARLVSNFEIMPPAGLREVDVSEKGGQFSLHIA | |||
Physicochemical properties | |||
| Number of amino acids: | 225 | ||
| Molecular weight: | 11,512.162 | ||
| Theoretical pI: | 10.852 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 125 | ||
| Instability index: | 37.950 | ||
| aromaticity | 0.064 | ||
| GRAVY | 0.062 | ||
Secondary Structure Fraction | |||
| Helix | 0.257 | ||
| turn | 0.385 | ||
| sheet | 0.229 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343360.1 | 5prime_partial | 109 | 675-346(-) |
Amino Acid sequence : | |||
| AMCRLNCPPFSLTSTSLNPAGGIISKFETSLAMIRPRMGSARIIPGQLLLPIPNGKNLKSTLPPATAASVPLSSSMNRSGRNSSGFFHHSGLLDSHHAFTTTFDSFGIV* | |||
Physicochemical properties | |||
| Number of amino acids: | 109 | ||
| Molecular weight: | 11,512.162 | ||
| Theoretical pI: | 10.852 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 125 | ||
| Instability index: | 37.950 | ||
| aromaticity | 0.064 | ||
| GRAVY | 0.062 | ||
Secondary Structure Fraction | |||
| Helix | 0.257 | ||
| turn | 0.385 | ||
| sheet | 0.229 | ||