| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343366.1 | internal | 252 | 2-757(+) |
Amino Acid sequence : | |||
| PLDPVFDGANFQVLPALANAFHAIQPLKVPGFSFAWLELISHRSFMPKLLTANAQKGWPYFQRLLVDLFQFMEPFLRNAELGEPVQFLYKGTLRVLLVLLHDFPEFLCDYHFSFCDVIPP SCIQMRNIILSAFPRNMRLPDPSTPNLKIDLLAEISQSPRILSEVDAALKAKQIKNDVDEYLKTRQQGSPFLTELKQKLLLSPADAARAGTRYNVPLINSLVLYVGMQAIQQLQARAQTM ANMGAFLVSAAL | |||
Physicochemical properties | |||
| Number of amino acids: | 252 | ||
| Molecular weight: | 28,373.878 | ||
| Theoretical pI: | 8.560 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19940 20065 | ||
| Instability index: | 42.363 | ||
| aromaticity | 0.103 | ||
| GRAVY | 0.138 | ||
Secondary Structure Fraction | |||
| Helix | 0.361 | ||
| turn | 0.214 | ||
| sheet | 0.317 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343366.1 | internal | 252 | 2-757(+) |
Amino Acid sequence : | |||
| PLDPVFDGANFQVLPALANAFHAIQPLKVPGFSFAWLELISHRSFMPKLLTANAQKGWPYFQRLLVDLFQFMEPFLRNAELGEPVQFLYKGTLRVLLVLLHDFPEFLCDYHFSFCDVIPP SCIQMRNIILSAFPRNMRLPDPSTPNLKIDLLAEISQSPRILSEVDAALKAKQIKNDVDEYLKTRQQGSPFLTELKQKLLLSPADAARAGTRYNVPLINSLVLYVGMQAIQQLQARAQTM ANMGAFLVSAAL | |||
Physicochemical properties | |||
| Number of amino acids: | 252 | ||
| Molecular weight: | 28,373.878 | ||
| Theoretical pI: | 8.560 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19940 20065 | ||
| Instability index: | 42.363 | ||
| aromaticity | 0.103 | ||
| GRAVY | 0.138 | ||
Secondary Structure Fraction | |||
| Helix | 0.361 | ||
| turn | 0.214 | ||
| sheet | 0.317 | ||