Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY343367.1 | 5prime_partial | 200 | 797-195(-) |
Amino Acid sequence : | |||
RQQGFPFLTELKQKLLLFPADAARAGTRYNVPLINSLVLYVGMQAIQQLQARAQTMANMGAFLVSAALDIFQTLIVDLDTEGRYLFLNAVANQLRYPNNHTHYFSFILLYLFAESNQEMI QEQITRVLLERLIVNRPHPWGLLITFIELIKNLRYNFWSRSFTRCAPEIEKLFESVSRSCGGPKPVDDSVVSGGIPENLH* | |||
Physicochemical properties | |||
Number of amino acids: | 200 | ||
Molecular weight: | 15,197.612 | ||
Theoretical pI: | 10.243 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19940 20065 | ||
Instability index: | 26.171 | ||
aromaticity | 0.094 | ||
GRAVY | -0.583 | ||
Secondary Structure Fraction | |||
Helix | 0.331 | ||
turn | 0.181 | ||
sheet | 0.213 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY343367.1 | complete | 127 | 135-518(+) |
Amino Acid sequence : | |||
MGKYGRIYTNGRQVRKLLRQLMEVFRYTTRYNTVVNRFRPTAGPRYRFKQLLDLWRASSKRPTPEVVPQILNQLDKCNQKTPRMRPIHDQTLQEYSCDLLLNHFLVRLSKQIKENEGEVM CVVVWIA* | |||
Physicochemical properties | |||
Number of amino acids: | 127 | ||
Molecular weight: | 15,197.612 | ||
Theoretical pI: | 10.243 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19940 20065 | ||
Instability index: | 26.171 | ||
aromaticity | 0.094 | ||
GRAVY | -0.583 | ||
Secondary Structure Fraction | |||
Helix | 0.331 | ||
turn | 0.181 | ||
sheet | 0.213 |