Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY343372.1 | 5prime_partial | 244 | 834-100(-) |
Amino Acid sequence : | |||
DNYATVNEAQLFTEILDRWSMDEIDRLPDYMKIVLHFVMSAYEEYERDAKKNGKKFASPYFKETIQQLARGYNQELKWVMEKQMPPFKDYLKNSEITSSIYIMFASIIPGLKSFTQEAID WIKNEPNFAVKAGLIGRYWDDIGSHKRESKGGEMLTVMDCYMKQYSVSIQETISEFAKAVEDSWKEVNEGWVYTISMPKEITVQFLNYSRMCDASYNRNNGDGYTDPSFAKSNITALFVD PIII* | |||
Physicochemical properties | |||
Number of amino acids: | 244 | ||
Molecular weight: | 28,403.939 | ||
Theoretical pI: | 4.988 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 55350 55475 | ||
Instability index: | 37.426 | ||
aromaticity | 0.135 | ||
GRAVY | -0.463 | ||
Secondary Structure Fraction | |||
Helix | 0.320 | ||
turn | 0.213 | ||
sheet | 0.238 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY343372.1 | 5prime_partial | 244 | 834-100(-) |
Amino Acid sequence : | |||
DNYATVNEAQLFTEILDRWSMDEIDRLPDYMKIVLHFVMSAYEEYERDAKKNGKKFASPYFKETIQQLARGYNQELKWVMEKQMPPFKDYLKNSEITSSIYIMFASIIPGLKSFTQEAID WIKNEPNFAVKAGLIGRYWDDIGSHKRESKGGEMLTVMDCYMKQYSVSIQETISEFAKAVEDSWKEVNEGWVYTISMPKEITVQFLNYSRMCDASYNRNNGDGYTDPSFAKSNITALFVD PIII* | |||
Physicochemical properties | |||
Number of amino acids: | 244 | ||
Molecular weight: | 28,403.939 | ||
Theoretical pI: | 4.988 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 55350 55475 | ||
Instability index: | 37.426 | ||
aromaticity | 0.135 | ||
GRAVY | -0.463 | ||
Secondary Structure Fraction | |||
Helix | 0.320 | ||
turn | 0.213 | ||
sheet | 0.238 |