| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343373.1 | internal | 262 | 3-788(+) |
Amino Acid sequence : | |||
| LPPLSLSLSHSHTMERARKLANRAILRRLVSESKQQPLHKSSRYVSSLSPSVVNNAAGFNHHRFNSRNLAQFVGTRSISVEALKPSDTFPRRHNSASPDEQSKMADFVGFNSLDSLIDAT VPKSIRSDEMKFSIFDEGLTEAQMIDHMKYLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPAWYTQYTPYQAEISQGRLESLLNYQTLITDLTGLPMSNASLLDEGTAAAEAMAMCNN IQKGKKKTFVIASNCHPQTIDI | |||
Physicochemical properties | |||
| Number of amino acids: | 262 | ||
| Molecular weight: | 11,040.688 | ||
| Theoretical pI: | 11.801 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 125 | ||
| Instability index: | 96.174 | ||
| aromaticity | 0.020 | ||
| GRAVY | -0.466 | ||
Secondary Structure Fraction | |||
| Helix | 0.242 | ||
| turn | 0.253 | ||
| sheet | 0.313 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343373.1 | 5prime_partial | 111 | 788-453(-) |
Amino Acid sequence : | |||
| DINRLRVAVASNHERLLLPLLNVVAHRHRLCSGSPFIEQRGVRHRQTGEVSDERLVIQQGLKPPLRNLSLIRGILSIPRRILHDVPQNHRRHKGIIIPHPNIRLENLVFRG* | |||
Physicochemical properties | |||
| Number of amino acids: | 111 | ||
| Molecular weight: | 11,040.688 | ||
| Theoretical pI: | 11.801 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 125 | ||
| Instability index: | 96.174 | ||
| aromaticity | 0.020 | ||
| GRAVY | -0.466 | ||
Secondary Structure Fraction | |||
| Helix | 0.242 | ||
| turn | 0.253 | ||
| sheet | 0.313 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343373.1 | 5prime_partial | 99 | 2-301(+) |
Amino Acid sequence : | |||
| SSSSLPLSLSLTHHGACEEAGQQSHIEAPRLRIQAAAIAQIFQVRLLLISQRRKQCRRLQSPPLQFAKPRPIRRHSLHLRGGAEAERHLPPPPQLRLAG* | |||
Physicochemical properties | |||
| Number of amino acids: | 99 | ||
| Molecular weight: | 11,040.688 | ||
| Theoretical pI: | 11.801 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 125 | ||
| Instability index: | 96.174 | ||
| aromaticity | 0.020 | ||
| GRAVY | -0.466 | ||
Secondary Structure Fraction | |||
| Helix | 0.242 | ||
| turn | 0.253 | ||
| sheet | 0.313 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343373.1 | internal | 262 | 3-788(+) |
Amino Acid sequence : | |||
| LPPLSLSLSHSHTMERARKLANRAILRRLVSESKQQPLHKSSRYVSSLSPSVVNNAAGFNHHRFNSRNLAQFVGTRSISVEALKPSDTFPRRHNSASPDEQSKMADFVGFNSLDSLIDAT VPKSIRSDEMKFSIFDEGLTEAQMIDHMKYLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPAWYTQYTPYQAEISQGRLESLLNYQTLITDLTGLPMSNASLLDEGTAAAEAMAMCNN IQKGKKKTFVIASNCHPQTIDI | |||
Physicochemical properties | |||
| Number of amino acids: | 262 | ||
| Molecular weight: | 11,040.688 | ||
| Theoretical pI: | 11.801 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 125 | ||
| Instability index: | 96.174 | ||
| aromaticity | 0.020 | ||
| GRAVY | -0.466 | ||
Secondary Structure Fraction | |||
| Helix | 0.242 | ||
| turn | 0.253 | ||
| sheet | 0.313 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343373.1 | 5prime_partial | 111 | 788-453(-) |
Amino Acid sequence : | |||
| DINRLRVAVASNHERLLLPLLNVVAHRHRLCSGSPFIEQRGVRHRQTGEVSDERLVIQQGLKPPLRNLSLIRGILSIPRRILHDVPQNHRRHKGIIIPHPNIRLENLVFRG* | |||
Physicochemical properties | |||
| Number of amino acids: | 111 | ||
| Molecular weight: | 11,040.688 | ||
| Theoretical pI: | 11.801 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 125 | ||
| Instability index: | 96.174 | ||
| aromaticity | 0.020 | ||
| GRAVY | -0.466 | ||
Secondary Structure Fraction | |||
| Helix | 0.242 | ||
| turn | 0.253 | ||
| sheet | 0.313 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343373.1 | 5prime_partial | 99 | 2-301(+) |
Amino Acid sequence : | |||
| SSSSLPLSLSLTHHGACEEAGQQSHIEAPRLRIQAAAIAQIFQVRLLLISQRRKQCRRLQSPPLQFAKPRPIRRHSLHLRGGAEAERHLPPPPQLRLAG* | |||
Physicochemical properties | |||
| Number of amino acids: | 99 | ||
| Molecular weight: | 11,040.688 | ||
| Theoretical pI: | 11.801 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 125 | ||
| Instability index: | 96.174 | ||
| aromaticity | 0.020 | ||
| GRAVY | -0.466 | ||
Secondary Structure Fraction | |||
| Helix | 0.242 | ||
| turn | 0.253 | ||
| sheet | 0.313 | ||