Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY343380.1 | 5prime_partial | 227 | 1-684(+) |
Amino Acid sequence : | |||
PLRNRGSGGSSPNGRRNESGGSSSGIGGGAIAGIVIAVLVVGAVAAFFIVKRRSRKSSTDIEKLDNQPFTPQAPEAVQEVKPVEFSSAASAKPFEAPPMINLRPPPADRHKSFDEDDITA KPIVPPKKVNIAPIDAKSFSVADLQIATDSFNVENLIGEGSVGRVFRAQLDDGKVVAVKKINASVLSNSEDFLEIVSEISRLHHPNIVELIGYCCEHGQHLLVFEVS* | |||
Physicochemical properties | |||
Number of amino acids: | 227 | ||
Molecular weight: | 24,158.097 | ||
Theoretical pI: | 6.263 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1615 | ||
Instability index: | 49.919 | ||
aromaticity | 0.053 | ||
GRAVY | -0.132 | ||
Secondary Structure Fraction | |||
Helix | 0.291 | ||
turn | 0.308 | ||
sheet | 0.220 |