Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY343386.1 | 5prime_partial | 203 | 3-614(+) |
Amino Acid sequence : | |||
LRPPETMVHVSFYRYYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARNLLTLDEKDPRRIFEGEALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTL VFKAGMTKSIHHARVLIRQRHIRVGRQVVNVPSFLVRVDSQKHIDFSLTSPFGGGRPGRVKRRNQKAAAKKASGGDGDEDDEE* | |||
Physicochemical properties | |||
Number of amino acids: | 203 | ||
Molecular weight: | 15,659.281 | ||
Theoretical pI: | 9.468 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 125 | ||
Instability index: | 58.493 | ||
aromaticity | 0.035 | ||
GRAVY | 0.013 | ||
Secondary Structure Fraction | |||
Helix | 0.333 | ||
turn | 0.248 | ||
sheet | 0.262 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY343386.1 | 3prime_partial | 141 | 425-3(-) |
Amino Acid sequence : | |||
MPLPDENSSMVNGLRHTSLKHKSLQATLKEVLDSKSQDIIKLVLALIEEPIPVHPPQKSFTFENTARILLIKSQEISCIIPNAAQSILNPPQLSLAPESIFTNKFQLSIQPLLLIGTTGL LKCLPIVAVKRDVHHGFRRTK | |||
Physicochemical properties | |||
Number of amino acids: | 141 | ||
Molecular weight: | 15,659.281 | ||
Theoretical pI: | 9.468 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 125 | ||
Instability index: | 58.493 | ||
aromaticity | 0.035 | ||
GRAVY | 0.013 | ||
Secondary Structure Fraction | |||
Helix | 0.333 | ||
turn | 0.248 | ||
sheet | 0.262 |