| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343386.1 | 5prime_partial | 203 | 3-614(+) |
Amino Acid sequence : | |||
| LRPPETMVHVSFYRYYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARNLLTLDEKDPRRIFEGEALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTL VFKAGMTKSIHHARVLIRQRHIRVGRQVVNVPSFLVRVDSQKHIDFSLTSPFGGGRPGRVKRRNQKAAAKKASGGDGDEDDEE* | |||
Physicochemical properties | |||
| Number of amino acids: | 203 | ||
| Molecular weight: | 15,659.281 | ||
| Theoretical pI: | 9.468 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 125 | ||
| Instability index: | 58.493 | ||
| aromaticity | 0.035 | ||
| GRAVY | 0.013 | ||
Secondary Structure Fraction | |||
| Helix | 0.333 | ||
| turn | 0.248 | ||
| sheet | 0.262 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343386.1 | 3prime_partial | 141 | 425-3(-) |
Amino Acid sequence : | |||
| MPLPDENSSMVNGLRHTSLKHKSLQATLKEVLDSKSQDIIKLVLALIEEPIPVHPPQKSFTFENTARILLIKSQEISCIIPNAAQSILNPPQLSLAPESIFTNKFQLSIQPLLLIGTTGL LKCLPIVAVKRDVHHGFRRTK | |||
Physicochemical properties | |||
| Number of amino acids: | 141 | ||
| Molecular weight: | 15,659.281 | ||
| Theoretical pI: | 9.468 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 125 | ||
| Instability index: | 58.493 | ||
| aromaticity | 0.035 | ||
| GRAVY | 0.013 | ||
Secondary Structure Fraction | |||
| Helix | 0.333 | ||
| turn | 0.248 | ||
| sheet | 0.262 | ||