Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY343395.1 | complete | 235 | 71-778(+) |
Amino Acid sequence : | |||
MAMASSLPSPLTIKTSLKQPDVKLPGVGPCAARSLPLPSLKLTARPSSSSVPVVVAAATSMVGAETQAGAATPAKVLPFRVGHGFDLHRLEPGYPLIIGGINIPHDRGCEAHSDGDVLLH CVVDAILGALGLPDIGQIFPDTDPKWKGAPSSVFMEEAVRLMHEAGYELGNLDATLILQRPKVSPHKEAIRANLCKLLGADPSVVNLKAKTHEKVDSLGENRSIAAHTVVLLFRK* | |||
Physicochemical properties | |||
Number of amino acids: | 235 | ||
Molecular weight: | 24,739.507 | ||
Theoretical pI: | 8.349 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8730 | ||
Instability index: | 37.357 | ||
aromaticity | 0.034 | ||
GRAVY | 0.089 | ||
Secondary Structure Fraction | |||
Helix | 0.289 | ||
turn | 0.268 | ||
sheet | 0.298 |