Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY343411.1 | 5prime_partial | 222 | 3-671(+) |
Amino Acid sequence : | |||
TLAAFATATLLASSSRQLKRPFSLLCPHRRPTSFLSMNSPTLPLRHPQPLRFSTVPRASAIIAVGDKLPDATLSYFDSANELQTVSISDLTSNKKAVLFAVPGAFTPTCSQKHLPGFVAK AGDLKAKGVETIACISVNDAFVMKAWKEDLKIGDEVMLLSDGNGEFTRAIGCELDLSDKPVGLGVRSRRYAMYVENGVVKILNLEEGGAFNVSSAEDMLKAI* | |||
Physicochemical properties | |||
Number of amino acids: | 222 | ||
Molecular weight: | 14,719.739 | ||
Theoretical pI: | 9.432 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4720 | ||
Instability index: | 60.202 | ||
aromaticity | 0.055 | ||
GRAVY | -0.351 | ||
Secondary Structure Fraction | |||
Helix | 0.315 | ||
turn | 0.236 | ||
sheet | 0.220 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY343411.1 | complete | 147 | 667-224(-) |
Amino Acid sequence : | |||
MALSMSSALLTLNAPPSSKFNIFTTPFSTYIAYLLDLTPNPTGLSLKSSSHPIARVNSPFPSLNSITSSPIFKSSFHAFITNASFTEMQAIVSTPFAFKSPAFATNPGRCFWEQVGVNAP GTANRTAFLLDVKSEMETVWSSLAESK* | |||
Physicochemical properties | |||
Number of amino acids: | 147 | ||
Molecular weight: | 14,719.739 | ||
Theoretical pI: | 9.432 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4720 | ||
Instability index: | 60.202 | ||
aromaticity | 0.055 | ||
GRAVY | -0.351 | ||
Secondary Structure Fraction | |||
Helix | 0.315 | ||
turn | 0.236 | ||
sheet | 0.220 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY343411.1 | 5prime_partial | 127 | 725-342(-) |
Amino Acid sequence : | |||
HFSSTSISCLCKQKQDLRSDGLEHVLSAANIERTALLQIQYLHYSILNVHRIPPRPNPQSHRLIAQIQLTSNRPCEFPISIAQQHYLIPNFQILLPRLHHERIVHRNASDRLHPLCLQIT SFRHESG* | |||
Physicochemical properties | |||
Number of amino acids: | 127 | ||
Molecular weight: | 14,719.739 | ||
Theoretical pI: | 9.432 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4720 | ||
Instability index: | 60.202 | ||
aromaticity | 0.055 | ||
GRAVY | -0.351 | ||
Secondary Structure Fraction | |||
Helix | 0.315 | ||
turn | 0.236 | ||
sheet | 0.220 |