Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY343416.1 | internal | 192 | 3-578(+) |
Amino Acid sequence : | |||
ASQRAKMDPVSEWGNSSLSAVDPEIHDLIEKEKRRQCRGIELIASENFTSFAVIEALGSALTNKYSEGMPGNRYYGGNEFIDEIENLTRSRALQAYRLDPTRWGVNVQPYSGSPANFAAY TAVLNPHDRIMGLDLPSGGHLTHGYYTSGGKKISATSIYFESLPYKVDSKTGYIDYERLEEKALDFRPKLII | |||
Physicochemical properties | |||
Number of amino acids: | 192 | ||
Molecular weight: | 10,335.555 | ||
Theoretical pI: | 4.550 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
Instability index: | 37.712 | ||
aromaticity | 0.020 | ||
GRAVY | 0.322 | ||
Secondary Structure Fraction | |||
Helix | 0.333 | ||
turn | 0.245 | ||
sheet | 0.314 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY343416.1 | 5prime_partial | 190 | 1-573(+) |
Amino Acid sequence : | |||
SHHRERKWIQSQSGATPRSPPWTPRSTTSSRRRSAANAAASSSSPPRTSPPSPSSRPSAAPSPTSTPRACPATATTAATSSSTRSRTSRAHAPSRPTASTPPAGASTSSPTAALRPTSPP TPPSSTPTTASWASICPPAATSPTDTTHPAGRRSVRPRFTSRACPIRWIRRLGTSITSDWRRRRWISARN* | |||
Physicochemical properties | |||
Number of amino acids: | 190 | ||
Molecular weight: | 10,335.555 | ||
Theoretical pI: | 4.550 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
Instability index: | 37.712 | ||
aromaticity | 0.020 | ||
GRAVY | 0.322 | ||
Secondary Structure Fraction | |||
Helix | 0.333 | ||
turn | 0.245 | ||
sheet | 0.314 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY343416.1 | 5prime_partial | 165 | 2-499(+) |
Amino Acid sequence : | |||
RITESENGSSLRVGQLLALRRGPRDPRPHREGEAPPMPRHRAHRLRELHLLRRHRGPRQRPHQQVLRGHARQPLLRRQRVHRRDREPHALTRPPGLPPRPHPLGRQRPALQRLSGQLRRL HRRPQPPRPHHGPRSALRRPPHPRILHIRREEDQCDLDLLRELAL* | |||
Physicochemical properties | |||
Number of amino acids: | 165 | ||
Molecular weight: | 10,335.555 | ||
Theoretical pI: | 4.550 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
Instability index: | 37.712 | ||
aromaticity | 0.020 | ||
GRAVY | 0.322 | ||
Secondary Structure Fraction | |||
Helix | 0.333 | ||
turn | 0.245 | ||
sheet | 0.314 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY343416.1 | 5prime_partial | 102 | 578-270(-) |
Amino Acid sequence : | |||
YNQFRAEIQRLLLQSLVIDVPSLRIHLIGQALEVNRGRTDLLPAGCVVSVGEVAAGGQIEAHDAVVGVEDGGVGGEVGRRAAVGLDVDAPAGGVEAVGLEGA* | |||
Physicochemical properties | |||
Number of amino acids: | 102 | ||
Molecular weight: | 10,335.555 | ||
Theoretical pI: | 4.550 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
Instability index: | 37.712 | ||
aromaticity | 0.020 | ||
GRAVY | 0.322 | ||
Secondary Structure Fraction | |||
Helix | 0.333 | ||
turn | 0.245 | ||
sheet | 0.314 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY343416.1 | internal | 192 | 3-578(+) |
Amino Acid sequence : | |||
ASQRAKMDPVSEWGNSSLSAVDPEIHDLIEKEKRRQCRGIELIASENFTSFAVIEALGSALTNKYSEGMPGNRYYGGNEFIDEIENLTRSRALQAYRLDPTRWGVNVQPYSGSPANFAAY TAVLNPHDRIMGLDLPSGGHLTHGYYTSGGKKISATSIYFESLPYKVDSKTGYIDYERLEEKALDFRPKLII | |||
Physicochemical properties | |||
Number of amino acids: | 192 | ||
Molecular weight: | 10,335.555 | ||
Theoretical pI: | 4.550 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
Instability index: | 37.712 | ||
aromaticity | 0.020 | ||
GRAVY | 0.322 | ||
Secondary Structure Fraction | |||
Helix | 0.333 | ||
turn | 0.245 | ||
sheet | 0.314 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY343416.1 | 5prime_partial | 190 | 1-573(+) |
Amino Acid sequence : | |||
SHHRERKWIQSQSGATPRSPPWTPRSTTSSRRRSAANAAASSSSPPRTSPPSPSSRPSAAPSPTSTPRACPATATTAATSSSTRSRTSRAHAPSRPTASTPPAGASTSSPTAALRPTSPP TPPSSTPTTASWASICPPAATSPTDTTHPAGRRSVRPRFTSRACPIRWIRRLGTSITSDWRRRRWISARN* | |||
Physicochemical properties | |||
Number of amino acids: | 190 | ||
Molecular weight: | 10,335.555 | ||
Theoretical pI: | 4.550 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
Instability index: | 37.712 | ||
aromaticity | 0.020 | ||
GRAVY | 0.322 | ||
Secondary Structure Fraction | |||
Helix | 0.333 | ||
turn | 0.245 | ||
sheet | 0.314 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY343416.1 | 5prime_partial | 165 | 2-499(+) |
Amino Acid sequence : | |||
RITESENGSSLRVGQLLALRRGPRDPRPHREGEAPPMPRHRAHRLRELHLLRRHRGPRQRPHQQVLRGHARQPLLRRQRVHRRDREPHALTRPPGLPPRPHPLGRQRPALQRLSGQLRRL HRRPQPPRPHHGPRSALRRPPHPRILHIRREEDQCDLDLLRELAL* | |||
Physicochemical properties | |||
Number of amino acids: | 165 | ||
Molecular weight: | 10,335.555 | ||
Theoretical pI: | 4.550 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
Instability index: | 37.712 | ||
aromaticity | 0.020 | ||
GRAVY | 0.322 | ||
Secondary Structure Fraction | |||
Helix | 0.333 | ||
turn | 0.245 | ||
sheet | 0.314 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY343416.1 | 5prime_partial | 102 | 578-270(-) |
Amino Acid sequence : | |||
YNQFRAEIQRLLLQSLVIDVPSLRIHLIGQALEVNRGRTDLLPAGCVVSVGEVAAGGQIEAHDAVVGVEDGGVGGEVGRRAAVGLDVDAPAGGVEAVGLEGA* | |||
Physicochemical properties | |||
Number of amino acids: | 102 | ||
Molecular weight: | 10,335.555 | ||
Theoretical pI: | 4.550 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
Instability index: | 37.712 | ||
aromaticity | 0.020 | ||
GRAVY | 0.322 | ||
Secondary Structure Fraction | |||
Helix | 0.333 | ||
turn | 0.245 | ||
sheet | 0.314 |