| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343416.1 | internal | 192 | 3-578(+) |
Amino Acid sequence : | |||
| ASQRAKMDPVSEWGNSSLSAVDPEIHDLIEKEKRRQCRGIELIASENFTSFAVIEALGSALTNKYSEGMPGNRYYGGNEFIDEIENLTRSRALQAYRLDPTRWGVNVQPYSGSPANFAAY TAVLNPHDRIMGLDLPSGGHLTHGYYTSGGKKISATSIYFESLPYKVDSKTGYIDYERLEEKALDFRPKLII | |||
Physicochemical properties | |||
| Number of amino acids: | 192 | ||
| Molecular weight: | 10,335.555 | ||
| Theoretical pI: | 4.550 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 37.712 | ||
| aromaticity | 0.020 | ||
| GRAVY | 0.322 | ||
Secondary Structure Fraction | |||
| Helix | 0.333 | ||
| turn | 0.245 | ||
| sheet | 0.314 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343416.1 | 5prime_partial | 190 | 1-573(+) |
Amino Acid sequence : | |||
| SHHRERKWIQSQSGATPRSPPWTPRSTTSSRRRSAANAAASSSSPPRTSPPSPSSRPSAAPSPTSTPRACPATATTAATSSSTRSRTSRAHAPSRPTASTPPAGASTSSPTAALRPTSPP TPPSSTPTTASWASICPPAATSPTDTTHPAGRRSVRPRFTSRACPIRWIRRLGTSITSDWRRRRWISARN* | |||
Physicochemical properties | |||
| Number of amino acids: | 190 | ||
| Molecular weight: | 10,335.555 | ||
| Theoretical pI: | 4.550 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 37.712 | ||
| aromaticity | 0.020 | ||
| GRAVY | 0.322 | ||
Secondary Structure Fraction | |||
| Helix | 0.333 | ||
| turn | 0.245 | ||
| sheet | 0.314 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343416.1 | 5prime_partial | 165 | 2-499(+) |
Amino Acid sequence : | |||
| RITESENGSSLRVGQLLALRRGPRDPRPHREGEAPPMPRHRAHRLRELHLLRRHRGPRQRPHQQVLRGHARQPLLRRQRVHRRDREPHALTRPPGLPPRPHPLGRQRPALQRLSGQLRRL HRRPQPPRPHHGPRSALRRPPHPRILHIRREEDQCDLDLLRELAL* | |||
Physicochemical properties | |||
| Number of amino acids: | 165 | ||
| Molecular weight: | 10,335.555 | ||
| Theoretical pI: | 4.550 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 37.712 | ||
| aromaticity | 0.020 | ||
| GRAVY | 0.322 | ||
Secondary Structure Fraction | |||
| Helix | 0.333 | ||
| turn | 0.245 | ||
| sheet | 0.314 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343416.1 | 5prime_partial | 102 | 578-270(-) |
Amino Acid sequence : | |||
| YNQFRAEIQRLLLQSLVIDVPSLRIHLIGQALEVNRGRTDLLPAGCVVSVGEVAAGGQIEAHDAVVGVEDGGVGGEVGRRAAVGLDVDAPAGGVEAVGLEGA* | |||
Physicochemical properties | |||
| Number of amino acids: | 102 | ||
| Molecular weight: | 10,335.555 | ||
| Theoretical pI: | 4.550 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 37.712 | ||
| aromaticity | 0.020 | ||
| GRAVY | 0.322 | ||
Secondary Structure Fraction | |||
| Helix | 0.333 | ||
| turn | 0.245 | ||
| sheet | 0.314 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343416.1 | internal | 192 | 3-578(+) |
Amino Acid sequence : | |||
| ASQRAKMDPVSEWGNSSLSAVDPEIHDLIEKEKRRQCRGIELIASENFTSFAVIEALGSALTNKYSEGMPGNRYYGGNEFIDEIENLTRSRALQAYRLDPTRWGVNVQPYSGSPANFAAY TAVLNPHDRIMGLDLPSGGHLTHGYYTSGGKKISATSIYFESLPYKVDSKTGYIDYERLEEKALDFRPKLII | |||
Physicochemical properties | |||
| Number of amino acids: | 192 | ||
| Molecular weight: | 10,335.555 | ||
| Theoretical pI: | 4.550 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 37.712 | ||
| aromaticity | 0.020 | ||
| GRAVY | 0.322 | ||
Secondary Structure Fraction | |||
| Helix | 0.333 | ||
| turn | 0.245 | ||
| sheet | 0.314 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343416.1 | 5prime_partial | 190 | 1-573(+) |
Amino Acid sequence : | |||
| SHHRERKWIQSQSGATPRSPPWTPRSTTSSRRRSAANAAASSSSPPRTSPPSPSSRPSAAPSPTSTPRACPATATTAATSSSTRSRTSRAHAPSRPTASTPPAGASTSSPTAALRPTSPP TPPSSTPTTASWASICPPAATSPTDTTHPAGRRSVRPRFTSRACPIRWIRRLGTSITSDWRRRRWISARN* | |||
Physicochemical properties | |||
| Number of amino acids: | 190 | ||
| Molecular weight: | 10,335.555 | ||
| Theoretical pI: | 4.550 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 37.712 | ||
| aromaticity | 0.020 | ||
| GRAVY | 0.322 | ||
Secondary Structure Fraction | |||
| Helix | 0.333 | ||
| turn | 0.245 | ||
| sheet | 0.314 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343416.1 | 5prime_partial | 165 | 2-499(+) |
Amino Acid sequence : | |||
| RITESENGSSLRVGQLLALRRGPRDPRPHREGEAPPMPRHRAHRLRELHLLRRHRGPRQRPHQQVLRGHARQPLLRRQRVHRRDREPHALTRPPGLPPRPHPLGRQRPALQRLSGQLRRL HRRPQPPRPHHGPRSALRRPPHPRILHIRREEDQCDLDLLRELAL* | |||
Physicochemical properties | |||
| Number of amino acids: | 165 | ||
| Molecular weight: | 10,335.555 | ||
| Theoretical pI: | 4.550 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 37.712 | ||
| aromaticity | 0.020 | ||
| GRAVY | 0.322 | ||
Secondary Structure Fraction | |||
| Helix | 0.333 | ||
| turn | 0.245 | ||
| sheet | 0.314 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343416.1 | 5prime_partial | 102 | 578-270(-) |
Amino Acid sequence : | |||
| YNQFRAEIQRLLLQSLVIDVPSLRIHLIGQALEVNRGRTDLLPAGCVVSVGEVAAGGQIEAHDAVVGVEDGGVGGEVGRRAAVGLDVDAPAGGVEAVGLEGA* | |||
Physicochemical properties | |||
| Number of amino acids: | 102 | ||
| Molecular weight: | 10,335.555 | ||
| Theoretical pI: | 4.550 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 37.712 | ||
| aromaticity | 0.020 | ||
| GRAVY | 0.322 | ||
Secondary Structure Fraction | |||
| Helix | 0.333 | ||
| turn | 0.245 | ||
| sheet | 0.314 | ||