| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343423.1 | internal | 166 | 2-499(+) |
Amino Acid sequence : | |||
| ALNMKITQISKKLIKPFTPTPENLKNYSISFLDKCMEHMNFAVILFYKSKPENITHLEESLAKILVQFYPLAGRYIKNDHIVDCSDQGVEFIEAEALDVELLDLIAKIETEQLNALLPYQ YLRLDEADPILGIKVTRFSDDGVSIAVSVHHTIFDMSSLGTFIAAW | |||
Physicochemical properties | |||
| Number of amino acids: | 166 | ||
| Molecular weight: | 18,849.603 | ||
| Theoretical pI: | 5.038 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 14440 14565 | ||
| Instability index: | 33.840 | ||
| aromaticity | 0.096 | ||
| GRAVY | 0.088 | ||
Secondary Structure Fraction | |||
| Helix | 0.373 | ||
| turn | 0.181 | ||
| sheet | 0.289 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343423.1 | internal | 166 | 2-499(+) |
Amino Acid sequence : | |||
| ALNMKITQISKKLIKPFTPTPENLKNYSISFLDKCMEHMNFAVILFYKSKPENITHLEESLAKILVQFYPLAGRYIKNDHIVDCSDQGVEFIEAEALDVELLDLIAKIETEQLNALLPYQ YLRLDEADPILGIKVTRFSDDGVSIAVSVHHTIFDMSSLGTFIAAW | |||
Physicochemical properties | |||
| Number of amino acids: | 166 | ||
| Molecular weight: | 18,849.603 | ||
| Theoretical pI: | 5.038 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 14440 14565 | ||
| Instability index: | 33.840 | ||
| aromaticity | 0.096 | ||
| GRAVY | 0.088 | ||
Secondary Structure Fraction | |||
| Helix | 0.373 | ||
| turn | 0.181 | ||
| sheet | 0.289 | ||