| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343427.1 | internal | 263 | 1-789(+) |
Amino Acid sequence : | |||
| TSPRERDPTRPGKMSLPLVFLTLLSAAALTAGEIRSTDIRSDGRPLILLDEFGFTHRGQLELNVSHLSLSGPKTDPPELQKIGFFLCTIDAWSHVLQQIEDAQITCVLGSDAIKKVFTFD RLPTPDAAAFNFSYAESSADQYTLIFANCLPQIKVFMDVRSAMYNLEGGGKSNRRDYLSAGKTILPRVYFLLAVIYFVLAGVWINVLYKKRNTVYGIHFFMLAVVLLKALNLLCEAEDKS YIKRTGSAHGWDVLXYIFSFLKG | |||
Physicochemical properties | |||
| Number of amino acids: | 263 | ||
| Molecular weight: | 20,117.461 | ||
| Theoretical pI: | 11.387 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 17990 18240 | ||
| Instability index: | 111.687 | ||
| aromaticity | 0.037 | ||
| GRAVY | -0.587 | ||
Secondary Structure Fraction | |||
| Helix | 0.162 | ||
| turn | 0.450 | ||
| sheet | 0.194 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343427.1 | 5prime_partial | 191 | 2-577(+) |
Amino Acid sequence : | |||
| LLREREIRLDPEKCLSLSSSSPSSPPLPSPPVRSAPPTSDPTAAPLSSLTSSASLTAASWSSTSPTSPYPAPKPTRRSSKKSDSSSAPSMPGLTCSSKLRMLRSRASSDPTQLRRSSPST ASPPQTPPPSISPTPSLRPINTRSSSLIASRRSRSSWTSAPRCTIWKAAENPTAGITSPPVKQFFLGFTSC* | |||
Physicochemical properties | |||
| Number of amino acids: | 191 | ||
| Molecular weight: | 20,117.461 | ||
| Theoretical pI: | 11.387 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 17990 18240 | ||
| Instability index: | 111.687 | ||
| aromaticity | 0.037 | ||
| GRAVY | -0.587 | ||
Secondary Structure Fraction | |||
| Helix | 0.162 | ||
| turn | 0.450 | ||
| sheet | 0.194 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343427.1 | internal | 263 | 1-789(+) |
Amino Acid sequence : | |||
| TSPRERDPTRPGKMSLPLVFLTLLSAAALTAGEIRSTDIRSDGRPLILLDEFGFTHRGQLELNVSHLSLSGPKTDPPELQKIGFFLCTIDAWSHVLQQIEDAQITCVLGSDAIKKVFTFD RLPTPDAAAFNFSYAESSADQYTLIFANCLPQIKVFMDVRSAMYNLEGGGKSNRRDYLSAGKTILPRVYFLLAVIYFVLAGVWINVLYKKRNTVYGIHFFMLAVVLLKALNLLCEAEDKS YIKRTGSAHGWDVLXYIFSFLKG | |||
Physicochemical properties | |||
| Number of amino acids: | 263 | ||
| Molecular weight: | 20,117.461 | ||
| Theoretical pI: | 11.387 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 17990 18240 | ||
| Instability index: | 111.687 | ||
| aromaticity | 0.037 | ||
| GRAVY | -0.587 | ||
Secondary Structure Fraction | |||
| Helix | 0.162 | ||
| turn | 0.450 | ||
| sheet | 0.194 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343427.1 | 5prime_partial | 191 | 2-577(+) |
Amino Acid sequence : | |||
| LLREREIRLDPEKCLSLSSSSPSSPPLPSPPVRSAPPTSDPTAAPLSSLTSSASLTAASWSSTSPTSPYPAPKPTRRSSKKSDSSSAPSMPGLTCSSKLRMLRSRASSDPTQLRRSSPST ASPPQTPPPSISPTPSLRPINTRSSSLIASRRSRSSWTSAPRCTIWKAAENPTAGITSPPVKQFFLGFTSC* | |||
Physicochemical properties | |||
| Number of amino acids: | 191 | ||
| Molecular weight: | 20,117.461 | ||
| Theoretical pI: | 11.387 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 17990 18240 | ||
| Instability index: | 111.687 | ||
| aromaticity | 0.037 | ||
| GRAVY | -0.587 | ||
Secondary Structure Fraction | |||
| Helix | 0.162 | ||
| turn | 0.450 | ||
| sheet | 0.194 | ||