Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY343437.1 | complete | 127 | 31-414(+) |
Amino Acid sequence : | |||
MADSKNLPYQSEGQKNPFVIFFTNLLSSIKLPFPPKKNGANSEPAAANPPAPADDDTKPALVKLPRQSFEPIKLEVEADETGQNTNPLILWQVYALGGVLVLRWAWMKWNERKGQKKSDN DPSSAHD* | |||
Physicochemical properties | |||
Number of amino acids: | 127 | ||
Molecular weight: | 14,113.799 | ||
Theoretical pI: | 6.584 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 24980 24980 | ||
Instability index: | 48.367 | ||
aromaticity | 0.087 | ||
GRAVY | -0.668 | ||
Secondary Structure Fraction | |||
Helix | 0.260 | ||
turn | 0.307 | ||
sheet | 0.260 |