| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343446.1 | internal | 250 | 2-751(+) |
Amino Acid sequence : | |||
| PCLDYGFKGAEIAMASYCSELQFLANPVTNHVQSAEQHNQDVNSLGLISSRKTVEALDILKLMSSTFLIALCQAIDLRHLEENLRAAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLR VVDREYVFAYIDDPCSATYPLMQKLRQVLVEHALNNGENEKNVSSSIFQKIQVFEEELKGVLPKEVEAARAAVEGGNPAVANRIKECRSYPLYKFVREELGTELLTGEKTTSPGEEGDKV FTALSNGLIV | |||
Physicochemical properties | |||
| Number of amino acids: | 250 | ||
| Molecular weight: | 11,703.181 | ||
| Theoretical pI: | 6.465 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14105 | ||
| Instability index: | 50.694 | ||
| aromaticity | 0.107 | ||
| GRAVY | 0.432 | ||
Secondary Structure Fraction | |||
| Helix | 0.330 | ||
| turn | 0.402 | ||
| sheet | 0.232 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343446.1 | 5prime_partial | 112 | 753-415(-) |
Amino Acid sequence : | |||
| STINPLLKAVNTLSPSSPGDVVFSPVNNSVPNSSLTNLYSGYDLHSLILLATAGFPPSTAALAASTSLGSTPLSSSSNTWIFWKMELLTFFSFSPLFKACSTSTCLSFCISG* | |||
Physicochemical properties | |||
| Number of amino acids: | 112 | ||
| Molecular weight: | 11,703.181 | ||
| Theoretical pI: | 6.465 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14105 | ||
| Instability index: | 50.694 | ||
| aromaticity | 0.107 | ||
| GRAVY | 0.432 | ||
Secondary Structure Fraction | |||
| Helix | 0.330 | ||
| turn | 0.402 | ||
| sheet | 0.232 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343446.1 | internal | 250 | 2-751(+) |
Amino Acid sequence : | |||
| PCLDYGFKGAEIAMASYCSELQFLANPVTNHVQSAEQHNQDVNSLGLISSRKTVEALDILKLMSSTFLIALCQAIDLRHLEENLRAAVKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLR VVDREYVFAYIDDPCSATYPLMQKLRQVLVEHALNNGENEKNVSSSIFQKIQVFEEELKGVLPKEVEAARAAVEGGNPAVANRIKECRSYPLYKFVREELGTELLTGEKTTSPGEEGDKV FTALSNGLIV | |||
Physicochemical properties | |||
| Number of amino acids: | 250 | ||
| Molecular weight: | 11,703.181 | ||
| Theoretical pI: | 6.465 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14105 | ||
| Instability index: | 50.694 | ||
| aromaticity | 0.107 | ||
| GRAVY | 0.432 | ||
Secondary Structure Fraction | |||
| Helix | 0.330 | ||
| turn | 0.402 | ||
| sheet | 0.232 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343446.1 | 5prime_partial | 112 | 753-415(-) |
Amino Acid sequence : | |||
| STINPLLKAVNTLSPSSPGDVVFSPVNNSVPNSSLTNLYSGYDLHSLILLATAGFPPSTAALAASTSLGSTPLSSSSNTWIFWKMELLTFFSFSPLFKACSTSTCLSFCISG* | |||
Physicochemical properties | |||
| Number of amino acids: | 112 | ||
| Molecular weight: | 11,703.181 | ||
| Theoretical pI: | 6.465 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14105 | ||
| Instability index: | 50.694 | ||
| aromaticity | 0.107 | ||
| GRAVY | 0.432 | ||
Secondary Structure Fraction | |||
| Helix | 0.330 | ||
| turn | 0.402 | ||
| sheet | 0.232 | ||