| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343448.1 | internal | 251 | 1-753(+) |
Amino Acid sequence : | |||
| RLMSLSELSAASGCPREPLYRLMRFLIFHGIFTKSDDCYAQSPLSRLFTRENLGPYMLMQATPVTRSPAGLSGEALKTGTSLYLKSIRGEDSWSDPAYGYHMKAFTNAMIAHARLTAAAI VRNYPAAFDGLRSVVDVGGRHGTAIGRLVEAFPWVRGIAFDLPEIVADAPPRKGVDFVGGDMFESVPKADAVMLMWILHDWSDDKCIEILKKCKEAIPASTGKVMIVDAIINEDGEGDEF SGARLSLDMIM | |||
Physicochemical properties | |||
| Number of amino acids: | 251 | ||
| Molecular weight: | 11,350.785 | ||
| Theoretical pI: | 11.184 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 6990 | ||
| Instability index: | 66.563 | ||
| aromaticity | 0.050 | ||
| GRAVY | -0.686 | ||
Secondary Structure Fraction | |||
| Helix | 0.238 | ||
| turn | 0.188 | ||
| sheet | 0.287 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343448.1 | 5prime_partial | 136 | 753-343(-) |
Amino Acid sequence : | |||
| HYHIQRQTSTRKLVAFSIFVNYSIYNHHFSGTRWNRFFAFLQNFYAFIVAPVMQYPHEHDRVGFRHAFKHVPSDEVDPFTRRSIRHNLRQIKRNSPHPRKRLHQSPDSRSVAAAHIHHRS QSVKRRRIVSYNGRRR* | |||
Physicochemical properties | |||
| Number of amino acids: | 136 | ||
| Molecular weight: | 11,350.785 | ||
| Theoretical pI: | 11.184 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 6990 | ||
| Instability index: | 66.563 | ||
| aromaticity | 0.050 | ||
| GRAVY | -0.686 | ||
Secondary Structure Fraction | |||
| Helix | 0.238 | ||
| turn | 0.188 | ||
| sheet | 0.287 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343448.1 | 5prime_partial | 128 | 755-369(-) |
Amino Acid sequence : | |||
| NIIISNDKRAPENSSPSPSSLIIASTIITFPVLAGIASLHFFRISMHLSSLQSCNIHMSMTASAFGTLSNMSPPTKSTPLRGGASATISGRSNAIPRTHGNASTSLPIAVPWRPPTSTTD RNPSNAAG* | |||
Physicochemical properties | |||
| Number of amino acids: | 128 | ||
| Molecular weight: | 11,350.785 | ||
| Theoretical pI: | 11.184 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 6990 | ||
| Instability index: | 66.563 | ||
| aromaticity | 0.050 | ||
| GRAVY | -0.686 | ||
Secondary Structure Fraction | |||
| Helix | 0.238 | ||
| turn | 0.188 | ||
| sheet | 0.287 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343448.1 | 3prime_partial | 101 | 303-1(-) |
Amino Acid sequence : | |||
| MVAVGRVAPRILTSDRLEIKACPRFQGFAAQARRRPRYRRRLHQHVGSQILSREKPRKRRLGVAVVGFGEDAVEDEESHEAVEWLAGAAGGGGELRQRHQT | |||
Physicochemical properties | |||
| Number of amino acids: | 101 | ||
| Molecular weight: | 11,350.785 | ||
| Theoretical pI: | 11.184 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 6990 | ||
| Instability index: | 66.563 | ||
| aromaticity | 0.050 | ||
| GRAVY | -0.686 | ||
Secondary Structure Fraction | |||
| Helix | 0.238 | ||
| turn | 0.188 | ||
| sheet | 0.287 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343448.1 | internal | 251 | 1-753(+) |
Amino Acid sequence : | |||
| RLMSLSELSAASGCPREPLYRLMRFLIFHGIFTKSDDCYAQSPLSRLFTRENLGPYMLMQATPVTRSPAGLSGEALKTGTSLYLKSIRGEDSWSDPAYGYHMKAFTNAMIAHARLTAAAI VRNYPAAFDGLRSVVDVGGRHGTAIGRLVEAFPWVRGIAFDLPEIVADAPPRKGVDFVGGDMFESVPKADAVMLMWILHDWSDDKCIEILKKCKEAIPASTGKVMIVDAIINEDGEGDEF SGARLSLDMIM | |||
Physicochemical properties | |||
| Number of amino acids: | 251 | ||
| Molecular weight: | 11,350.785 | ||
| Theoretical pI: | 11.184 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 6990 | ||
| Instability index: | 66.563 | ||
| aromaticity | 0.050 | ||
| GRAVY | -0.686 | ||
Secondary Structure Fraction | |||
| Helix | 0.238 | ||
| turn | 0.188 | ||
| sheet | 0.287 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343448.1 | 5prime_partial | 136 | 753-343(-) |
Amino Acid sequence : | |||
| HYHIQRQTSTRKLVAFSIFVNYSIYNHHFSGTRWNRFFAFLQNFYAFIVAPVMQYPHEHDRVGFRHAFKHVPSDEVDPFTRRSIRHNLRQIKRNSPHPRKRLHQSPDSRSVAAAHIHHRS QSVKRRRIVSYNGRRR* | |||
Physicochemical properties | |||
| Number of amino acids: | 136 | ||
| Molecular weight: | 11,350.785 | ||
| Theoretical pI: | 11.184 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 6990 | ||
| Instability index: | 66.563 | ||
| aromaticity | 0.050 | ||
| GRAVY | -0.686 | ||
Secondary Structure Fraction | |||
| Helix | 0.238 | ||
| turn | 0.188 | ||
| sheet | 0.287 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343448.1 | 5prime_partial | 128 | 755-369(-) |
Amino Acid sequence : | |||
| NIIISNDKRAPENSSPSPSSLIIASTIITFPVLAGIASLHFFRISMHLSSLQSCNIHMSMTASAFGTLSNMSPPTKSTPLRGGASATISGRSNAIPRTHGNASTSLPIAVPWRPPTSTTD RNPSNAAG* | |||
Physicochemical properties | |||
| Number of amino acids: | 128 | ||
| Molecular weight: | 11,350.785 | ||
| Theoretical pI: | 11.184 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 6990 | ||
| Instability index: | 66.563 | ||
| aromaticity | 0.050 | ||
| GRAVY | -0.686 | ||
Secondary Structure Fraction | |||
| Helix | 0.238 | ||
| turn | 0.188 | ||
| sheet | 0.287 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343448.1 | 3prime_partial | 101 | 303-1(-) |
Amino Acid sequence : | |||
| MVAVGRVAPRILTSDRLEIKACPRFQGFAAQARRRPRYRRRLHQHVGSQILSREKPRKRRLGVAVVGFGEDAVEDEESHEAVEWLAGAAGGGGELRQRHQT | |||
Physicochemical properties | |||
| Number of amino acids: | 101 | ||
| Molecular weight: | 11,350.785 | ||
| Theoretical pI: | 11.184 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 6990 | ||
| Instability index: | 66.563 | ||
| aromaticity | 0.050 | ||
| GRAVY | -0.686 | ||
Secondary Structure Fraction | |||
| Helix | 0.238 | ||
| turn | 0.188 | ||
| sheet | 0.287 | ||