Acc_NO	ORF type	length	start-end position (strand +/-)
>DY343453.1	5prime_partial	181	2-547(+)
Amino Acid sequence :
DKPSADVYPNASKCYDAVSAKLASSFPGKAVGVRIGGQAATAAAPAAEAKEAAGDDDDDDLDLFGDETEEEKKAAEQREAAKASSKKKESGKSSVLMDIKPWDDETDMKKLEESVRSVEV PGLLWGASKLVPVGYGIKKLQIMLTIVDDLVSVDSLIEEVLTAEPHNEYVQSCDIVAFNKI*
Physicochemical properties
Number of amino acids:		181
Molecular weight:		19,333.434
Theoretical pI:		4.503
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		16960 17085
Instability index:		40.166
aromaticity		0.050
GRAVY		-0.370
Secondary Structure Fraction
Helix		0.254
turn		0.210
sheet		0.315