| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343462.1 | 5prime_partial | 117 | 2-355(+) |
Amino Acid sequence : | |||
| LIPNHIFGTLTPESISDKAKDFVPKETSSTLGPNAILEKAKDIVPNHSSSMPAPEAILEKAKDIVPNRISRMPATEEILENTQDIVPNQISSSLAPKAILEKAKDIVPNKTSTTLVP* | |||
Physicochemical properties | |||
| Number of amino acids: | 117 | ||
| Molecular weight: | 12,605.322 | ||
| Theoretical pI: | 5.665 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
| Instability index: | 61.211 | ||
| aromaticity | 0.017 | ||
| GRAVY | -0.295 | ||
Secondary Structure Fraction | |||
| Helix | 0.256 | ||
| turn | 0.291 | ||
| sheet | 0.256 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343462.1 | 5prime_partial | 117 | 2-355(+) |
Amino Acid sequence : | |||
| LIPNHIFGTLTPESISDKAKDFVPKETSSTLGPNAILEKAKDIVPNHSSSMPAPEAILEKAKDIVPNRISRMPATEEILENTQDIVPNQISSSLAPKAILEKAKDIVPNKTSTTLVP* | |||
Physicochemical properties | |||
| Number of amino acids: | 117 | ||
| Molecular weight: | 12,605.322 | ||
| Theoretical pI: | 5.665 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
| Instability index: | 61.211 | ||
| aromaticity | 0.017 | ||
| GRAVY | -0.295 | ||
Secondary Structure Fraction | |||
| Helix | 0.256 | ||
| turn | 0.291 | ||
| sheet | 0.256 | ||