Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY343470.1 | complete | 148 | 526-80(-) |
Amino Acid sequence : | |||
MKIQVKHSTLVPPSAATPAVSLWNSNVDLVVPNFHTPSVYFYRPTGAANFFDTAVMKAALARALVPFYPMAGRLKRDEDGRIEIDCNAEGVLFVEAESDGTVDDYGDFAPTLELRRLIPA VDYSQGISAYPLLVLQVHYPYVLGFSVR* | |||
Physicochemical properties | |||
Number of amino acids: | 148 | ||
Molecular weight: | 12,468.958 | ||
Theoretical pI: | 9.502 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
Instability index: | 66.022 | ||
aromaticity | 0.018 | ||
GRAVY | -0.491 | ||
Secondary Structure Fraction | |||
Helix | 0.283 | ||
turn | 0.230 | ||
sheet | 0.239 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY343470.1 | complete | 113 | 113-454(+) |
Amino Acid sequence : | |||
MHLQDEKRVSRYSLRIIDGRNEAAKLQSGGEIAVIVHRAVGLRLHKEHSLGVAVDLDPPVFVPLQPPRHGVERHQSAGQRRLHHRRVEEVGGSGRAVEVDAGGVEIGHHQVNV* | |||
Physicochemical properties | |||
Number of amino acids: | 113 | ||
Molecular weight: | 12,468.958 | ||
Theoretical pI: | 9.502 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
Instability index: | 66.022 | ||
aromaticity | 0.018 | ||
GRAVY | -0.491 | ||
Secondary Structure Fraction | |||
Helix | 0.283 | ||
turn | 0.230 | ||
sheet | 0.239 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY343470.1 | complete | 148 | 526-80(-) |
Amino Acid sequence : | |||
MKIQVKHSTLVPPSAATPAVSLWNSNVDLVVPNFHTPSVYFYRPTGAANFFDTAVMKAALARALVPFYPMAGRLKRDEDGRIEIDCNAEGVLFVEAESDGTVDDYGDFAPTLELRRLIPA VDYSQGISAYPLLVLQVHYPYVLGFSVR* | |||
Physicochemical properties | |||
Number of amino acids: | 148 | ||
Molecular weight: | 12,468.958 | ||
Theoretical pI: | 9.502 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
Instability index: | 66.022 | ||
aromaticity | 0.018 | ||
GRAVY | -0.491 | ||
Secondary Structure Fraction | |||
Helix | 0.283 | ||
turn | 0.230 | ||
sheet | 0.239 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY343470.1 | complete | 113 | 113-454(+) |
Amino Acid sequence : | |||
MHLQDEKRVSRYSLRIIDGRNEAAKLQSGGEIAVIVHRAVGLRLHKEHSLGVAVDLDPPVFVPLQPPRHGVERHQSAGQRRLHHRRVEEVGGSGRAVEVDAGGVEIGHHQVNV* | |||
Physicochemical properties | |||
Number of amino acids: | 113 | ||
Molecular weight: | 12,468.958 | ||
Theoretical pI: | 9.502 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
Instability index: | 66.022 | ||
aromaticity | 0.018 | ||
GRAVY | -0.491 | ||
Secondary Structure Fraction | |||
Helix | 0.283 | ||
turn | 0.230 | ||
sheet | 0.239 |