| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343470.1 | complete | 148 | 526-80(-) |
Amino Acid sequence : | |||
| MKIQVKHSTLVPPSAATPAVSLWNSNVDLVVPNFHTPSVYFYRPTGAANFFDTAVMKAALARALVPFYPMAGRLKRDEDGRIEIDCNAEGVLFVEAESDGTVDDYGDFAPTLELRRLIPA VDYSQGISAYPLLVLQVHYPYVLGFSVR* | |||
Physicochemical properties | |||
| Number of amino acids: | 148 | ||
| Molecular weight: | 12,468.958 | ||
| Theoretical pI: | 9.502 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 66.022 | ||
| aromaticity | 0.018 | ||
| GRAVY | -0.491 | ||
Secondary Structure Fraction | |||
| Helix | 0.283 | ||
| turn | 0.230 | ||
| sheet | 0.239 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343470.1 | complete | 113 | 113-454(+) |
Amino Acid sequence : | |||
| MHLQDEKRVSRYSLRIIDGRNEAAKLQSGGEIAVIVHRAVGLRLHKEHSLGVAVDLDPPVFVPLQPPRHGVERHQSAGQRRLHHRRVEEVGGSGRAVEVDAGGVEIGHHQVNV* | |||
Physicochemical properties | |||
| Number of amino acids: | 113 | ||
| Molecular weight: | 12,468.958 | ||
| Theoretical pI: | 9.502 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 66.022 | ||
| aromaticity | 0.018 | ||
| GRAVY | -0.491 | ||
Secondary Structure Fraction | |||
| Helix | 0.283 | ||
| turn | 0.230 | ||
| sheet | 0.239 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343470.1 | complete | 148 | 526-80(-) |
Amino Acid sequence : | |||
| MKIQVKHSTLVPPSAATPAVSLWNSNVDLVVPNFHTPSVYFYRPTGAANFFDTAVMKAALARALVPFYPMAGRLKRDEDGRIEIDCNAEGVLFVEAESDGTVDDYGDFAPTLELRRLIPA VDYSQGISAYPLLVLQVHYPYVLGFSVR* | |||
Physicochemical properties | |||
| Number of amino acids: | 148 | ||
| Molecular weight: | 12,468.958 | ||
| Theoretical pI: | 9.502 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 66.022 | ||
| aromaticity | 0.018 | ||
| GRAVY | -0.491 | ||
Secondary Structure Fraction | |||
| Helix | 0.283 | ||
| turn | 0.230 | ||
| sheet | 0.239 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343470.1 | complete | 113 | 113-454(+) |
Amino Acid sequence : | |||
| MHLQDEKRVSRYSLRIIDGRNEAAKLQSGGEIAVIVHRAVGLRLHKEHSLGVAVDLDPPVFVPLQPPRHGVERHQSAGQRRLHHRRVEEVGGSGRAVEVDAGGVEIGHHQVNV* | |||
Physicochemical properties | |||
| Number of amino acids: | 113 | ||
| Molecular weight: | 12,468.958 | ||
| Theoretical pI: | 9.502 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 66.022 | ||
| aromaticity | 0.018 | ||
| GRAVY | -0.491 | ||
Secondary Structure Fraction | |||
| Helix | 0.283 | ||
| turn | 0.230 | ||
| sheet | 0.239 | ||