| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343476.1 | internal | 150 | 452-3(-) |
Amino Acid sequence : | |||
| LKKFKFAVSKGFDPATHLEKVGIANQTTMLKGETEEIGKLVENSMMRRYGVENINSPFISFNTICVGAQERQDATEKLIEEEVDMMIVIGGWNSSNTSSLQVITEDRGIPSYWVDTPERI GPGNRIAHKLAHGELVEKDDWIPKGPVTVG | |||
Physicochemical properties | |||
| Number of amino acids: | 150 | ||
| Molecular weight: | 16,660.756 | ||
| Theoretical pI: | 5.252 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19480 19480 | ||
| Instability index: | 30.341 | ||
| aromaticity | 0.067 | ||
| GRAVY | -0.379 | ||
Secondary Structure Fraction | |||
| Helix | 0.287 | ||
| turn | 0.253 | ||
| sheet | 0.233 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343476.1 | internal | 150 | 452-3(-) |
Amino Acid sequence : | |||
| LKKFKFAVSKGFDPATHLEKVGIANQTTMLKGETEEIGKLVENSMMRRYGVENINSPFISFNTICVGAQERQDATEKLIEEEVDMMIVIGGWNSSNTSSLQVITEDRGIPSYWVDTPERI GPGNRIAHKLAHGELVEKDDWIPKGPVTVG | |||
Physicochemical properties | |||
| Number of amino acids: | 150 | ||
| Molecular weight: | 16,660.756 | ||
| Theoretical pI: | 5.252 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19480 19480 | ||
| Instability index: | 30.341 | ||
| aromaticity | 0.067 | ||
| GRAVY | -0.379 | ||
Secondary Structure Fraction | |||
| Helix | 0.287 | ||
| turn | 0.253 | ||
| sheet | 0.233 | ||