| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343483.1 | 3prime_partial | 103 | 433-741(+) |
Amino Acid sequence : | |||
| MEGAYNRVLSARQTVPHETYVYFMDVLAKTVRDEIAGCSEKAYDSLSLNDARQMLLYSSDKELVEYITEEHPEWEIKNGFVFFQRAKESVPCKEIPSLLLINQ | |||
Physicochemical properties | |||
| Number of amino acids: | 103 | ||
| Molecular weight: | 11,938.413 | ||
| Theoretical pI: | 4.850 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 14440 14565 | ||
| Instability index: | 32.484 | ||
| aromaticity | 0.107 | ||
| GRAVY | -0.356 | ||
Secondary Structure Fraction | |||
| Helix | 0.330 | ||
| turn | 0.184 | ||
| sheet | 0.311 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343483.1 | 3prime_partial | 103 | 433-741(+) |
Amino Acid sequence : | |||
| MEGAYNRVLSARQTVPHETYVYFMDVLAKTVRDEIAGCSEKAYDSLSLNDARQMLLYSSDKELVEYITEEHPEWEIKNGFVFFQRAKESVPCKEIPSLLLINQ | |||
Physicochemical properties | |||
| Number of amino acids: | 103 | ||
| Molecular weight: | 11,938.413 | ||
| Theoretical pI: | 4.850 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 14440 14565 | ||
| Instability index: | 32.484 | ||
| aromaticity | 0.107 | ||
| GRAVY | -0.356 | ||
Secondary Structure Fraction | |||
| Helix | 0.330 | ||
| turn | 0.184 | ||
| sheet | 0.311 | ||