Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY343485.1 | internal | 249 | 3-749(+) |
Amino Acid sequence : | |||
TPQEERNRIPPISPPTMALLVEKTSSGREYKVKDMSQADFGRLEIDLAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAVIARDSA AVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKSGKLPDPSSTDNAEFQIVLTIIRDGLKENPTKYTKMKERLVGVSEETTTGVKRLYQMQANGTLLF PAINVNDSV | |||
Physicochemical properties | |||
Number of amino acids: | 249 | ||
Molecular weight: | 16,548.751 | ||
Theoretical pI: | 12.000 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 6990 | ||
Instability index: | 81.950 | ||
aromaticity | 0.021 | ||
GRAVY | -1.555 | ||
Secondary Structure Fraction | |||
Helix | 0.170 | ||
turn | 0.312 | ||
sheet | 0.149 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY343485.1 | 5prime_partial | 159 | 749-270(-) |
Amino Acid sequence : | |||
DRVVNVNGGEKQSAISLHLIQPLNASRRLLRNAHQSLLHLRILGRILLQSISDNRQHDLKFGVVGGARIRQLPALRVLLLRLHPLVNQQRRIAAVVDDQIRSAAGAPIKRALGAPPVFLE SLPLPGEDGGAVARDDGGGVVLRGEDVAGAPADLGAERG* | |||
Physicochemical properties | |||
Number of amino acids: | 159 | ||
Molecular weight: | 16,548.751 | ||
Theoretical pI: | 12.000 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 6990 | ||
Instability index: | 81.950 | ||
aromaticity | 0.021 | ||
GRAVY | -1.555 | ||
Secondary Structure Fraction | |||
Helix | 0.170 | ||
turn | 0.312 | ||
sheet | 0.149 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY343485.1 | 5prime_partial | 141 | 2-427(+) |
Amino Acid sequence : | |||
HSPRRKKQNPPNFPSYNGAPCRENQLRPRIQGQGHVSGRLRPPRNRPGRGRDARPHVVPHRIRPLPAIQGRQDHWKPPHDHPDRRPHRNPNRARRRGPLVLLQHLLHAGPRRRRHRARQR RRLRLEGGDSPGILVVHRARA* | |||
Physicochemical properties | |||
Number of amino acids: | 141 | ||
Molecular weight: | 16,548.751 | ||
Theoretical pI: | 12.000 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 6990 | ||
Instability index: | 81.950 | ||
aromaticity | 0.021 | ||
GRAVY | -1.555 | ||
Secondary Structure Fraction | |||
Helix | 0.170 | ||
turn | 0.312 | ||
sheet | 0.149 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY343485.1 | internal | 249 | 3-749(+) |
Amino Acid sequence : | |||
TPQEERNRIPPISPPTMALLVEKTSSGREYKVKDMSQADFGRLEIDLAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAVIARDSA AVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKSGKLPDPSSTDNAEFQIVLTIIRDGLKENPTKYTKMKERLVGVSEETTTGVKRLYQMQANGTLLF PAINVNDSV | |||
Physicochemical properties | |||
Number of amino acids: | 249 | ||
Molecular weight: | 16,548.751 | ||
Theoretical pI: | 12.000 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 6990 | ||
Instability index: | 81.950 | ||
aromaticity | 0.021 | ||
GRAVY | -1.555 | ||
Secondary Structure Fraction | |||
Helix | 0.170 | ||
turn | 0.312 | ||
sheet | 0.149 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY343485.1 | 5prime_partial | 159 | 749-270(-) |
Amino Acid sequence : | |||
DRVVNVNGGEKQSAISLHLIQPLNASRRLLRNAHQSLLHLRILGRILLQSISDNRQHDLKFGVVGGARIRQLPALRVLLLRLHPLVNQQRRIAAVVDDQIRSAAGAPIKRALGAPPVFLE SLPLPGEDGGAVARDDGGGVVLRGEDVAGAPADLGAERG* | |||
Physicochemical properties | |||
Number of amino acids: | 159 | ||
Molecular weight: | 16,548.751 | ||
Theoretical pI: | 12.000 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 6990 | ||
Instability index: | 81.950 | ||
aromaticity | 0.021 | ||
GRAVY | -1.555 | ||
Secondary Structure Fraction | |||
Helix | 0.170 | ||
turn | 0.312 | ||
sheet | 0.149 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY343485.1 | 5prime_partial | 141 | 2-427(+) |
Amino Acid sequence : | |||
HSPRRKKQNPPNFPSYNGAPCRENQLRPRIQGQGHVSGRLRPPRNRPGRGRDARPHVVPHRIRPLPAIQGRQDHWKPPHDHPDRRPHRNPNRARRRGPLVLLQHLLHAGPRRRRHRARQR RRLRLEGGDSPGILVVHRARA* | |||
Physicochemical properties | |||
Number of amino acids: | 141 | ||
Molecular weight: | 16,548.751 | ||
Theoretical pI: | 12.000 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 6990 | ||
Instability index: | 81.950 | ||
aromaticity | 0.021 | ||
GRAVY | -1.555 | ||
Secondary Structure Fraction | |||
Helix | 0.170 | ||
turn | 0.312 | ||
sheet | 0.149 |