| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343490.1 | 5prime_partial | 162 | 685-197(-) |
Amino Acid sequence : | |||
| RLIGHISFPKYLSIGTPHWHNPITHPQLKNIELYQVSFEDVKEVLIVLQLIGNSPNLKGLQISSFWTIFAAARAPALKFWDKNFSDDPALLELKVVKLTDVFGVPLEMRFIKFFLEHSPC LEEMSIPPSLYVPEGRLQMLIDLVSFRRAFPRASVIFFHEPM* | |||
Physicochemical properties | |||
| Number of amino acids: | 162 | ||
| Molecular weight: | 11,522.323 | ||
| Theoretical pI: | 10.191 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1615 | ||
| Instability index: | 37.601 | ||
| aromaticity | 0.075 | ||
| GRAVY | -0.264 | ||
Secondary Structure Fraction | |||
| Helix | 0.243 | ||
| turn | 0.318 | ||
| sheet | 0.215 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343490.1 | complete | 135 | 182-589(+) |
Amino Acid sequence : | |||
| MQKLQSHRLMKKNDRCSRKSASKAYQIYQHLQSSLWHVQTRGDAHFFQTRGMLQKKLYKPHFKRDTKNISQLHNFELQKGGIIGKVLVPKFQGRGPRCSKNGPKTGYLQPLQIRRIPNQL KHNQYFLNVFEANLI* | |||
Physicochemical properties | |||
| Number of amino acids: | 135 | ||
| Molecular weight: | 11,522.323 | ||
| Theoretical pI: | 10.191 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1615 | ||
| Instability index: | 37.601 | ||
| aromaticity | 0.075 | ||
| GRAVY | -0.264 | ||
Secondary Structure Fraction | |||
| Helix | 0.243 | ||
| turn | 0.318 | ||
| sheet | 0.215 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343490.1 | complete | 107 | 219-542(+) |
Amino Acid sequence : | |||
| MTDALGKARRKLTKSINICNLPSGTYKLGGMLISSKHGECSKKNFINLISSGTPKTSVNFTTLSSKRAGSSEKFLSQNFKAGARAAAKMVQKLDICSPFKFGEFPIS* | |||
Physicochemical properties | |||
| Number of amino acids: | 107 | ||
| Molecular weight: | 11,522.323 | ||
| Theoretical pI: | 10.191 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1615 | ||
| Instability index: | 37.601 | ||
| aromaticity | 0.075 | ||
| GRAVY | -0.264 | ||
Secondary Structure Fraction | |||
| Helix | 0.243 | ||
| turn | 0.318 | ||
| sheet | 0.215 | ||