Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY343490.1 | 5prime_partial | 162 | 685-197(-) |
Amino Acid sequence : | |||
RLIGHISFPKYLSIGTPHWHNPITHPQLKNIELYQVSFEDVKEVLIVLQLIGNSPNLKGLQISSFWTIFAAARAPALKFWDKNFSDDPALLELKVVKLTDVFGVPLEMRFIKFFLEHSPC LEEMSIPPSLYVPEGRLQMLIDLVSFRRAFPRASVIFFHEPM* | |||
Physicochemical properties | |||
Number of amino acids: | 162 | ||
Molecular weight: | 11,522.323 | ||
Theoretical pI: | 10.191 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1615 | ||
Instability index: | 37.601 | ||
aromaticity | 0.075 | ||
GRAVY | -0.264 | ||
Secondary Structure Fraction | |||
Helix | 0.243 | ||
turn | 0.318 | ||
sheet | 0.215 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY343490.1 | complete | 135 | 182-589(+) |
Amino Acid sequence : | |||
MQKLQSHRLMKKNDRCSRKSASKAYQIYQHLQSSLWHVQTRGDAHFFQTRGMLQKKLYKPHFKRDTKNISQLHNFELQKGGIIGKVLVPKFQGRGPRCSKNGPKTGYLQPLQIRRIPNQL KHNQYFLNVFEANLI* | |||
Physicochemical properties | |||
Number of amino acids: | 135 | ||
Molecular weight: | 11,522.323 | ||
Theoretical pI: | 10.191 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1615 | ||
Instability index: | 37.601 | ||
aromaticity | 0.075 | ||
GRAVY | -0.264 | ||
Secondary Structure Fraction | |||
Helix | 0.243 | ||
turn | 0.318 | ||
sheet | 0.215 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY343490.1 | complete | 107 | 219-542(+) |
Amino Acid sequence : | |||
MTDALGKARRKLTKSINICNLPSGTYKLGGMLISSKHGECSKKNFINLISSGTPKTSVNFTTLSSKRAGSSEKFLSQNFKAGARAAAKMVQKLDICSPFKFGEFPIS* | |||
Physicochemical properties | |||
Number of amino acids: | 107 | ||
Molecular weight: | 11,522.323 | ||
Theoretical pI: | 10.191 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1615 | ||
Instability index: | 37.601 | ||
aromaticity | 0.075 | ||
GRAVY | -0.264 | ||
Secondary Structure Fraction | |||
Helix | 0.243 | ||
turn | 0.318 | ||
sheet | 0.215 |