| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343500.1 | 5prime_partial | 220 | 686-24(-) |
Amino Acid sequence : | |||
| IICHSLVRAVWRSAQCGRGTGNHRTVLVVVLDGHLSLAVRPQPRARPVFPDLSETGAELRGKNMAQRHQLRGFIRGVAKHVALITSTDFLRAFGEVAMYTLSNIRALLLNIHQNLAVIRI KTYIIGDKSNGTACVTDNLLVVDISLGGYFSKHHDHVGFGAGLTSNLALRVLSKAGVQHCIGNLIAELVGVPLIHRLRCKQEGLHLSSLNLRSKEFQKGA* | |||
Physicochemical properties | |||
| Number of amino acids: | 220 | ||
| Molecular weight: | 20,928.396 | ||
| Theoretical pI: | 4.575 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11960 | ||
| Instability index: | 39.432 | ||
| aromaticity | 0.052 | ||
| GRAVY | -0.293 | ||
Secondary Structure Fraction | |||
| Helix | 0.250 | ||
| turn | 0.203 | ||
| sheet | 0.255 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343500.1 | complete | 192 | 72-650(+) |
Amino Acid sequence : | |||
| METFLFTSESVNEGHPDKLCDQISDAVLDACLAQDPESKVACETCTKTNMVMVFGEITTKADVDYEKIVRDTCRAIGFVSDDVGLDADNCKVLVNIEQQSPDIAQGVHGHLTKRPEEIGA GDQGHMFGYATDETPELMPLSHVLATKLGARLTEVRKNGTCPWLRPDGKTQVTVEYYNENGAMVPCPASTLC* | |||
Physicochemical properties | |||
| Number of amino acids: | 192 | ||
| Molecular weight: | 20,928.396 | ||
| Theoretical pI: | 4.575 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11960 | ||
| Instability index: | 39.432 | ||
| aromaticity | 0.052 | ||
| GRAVY | -0.293 | ||
Secondary Structure Fraction | |||
| Helix | 0.250 | ||
| turn | 0.203 | ||
| sheet | 0.255 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343500.1 | 5prime_partial | 220 | 686-24(-) |
Amino Acid sequence : | |||
| IICHSLVRAVWRSAQCGRGTGNHRTVLVVVLDGHLSLAVRPQPRARPVFPDLSETGAELRGKNMAQRHQLRGFIRGVAKHVALITSTDFLRAFGEVAMYTLSNIRALLLNIHQNLAVIRI KTYIIGDKSNGTACVTDNLLVVDISLGGYFSKHHDHVGFGAGLTSNLALRVLSKAGVQHCIGNLIAELVGVPLIHRLRCKQEGLHLSSLNLRSKEFQKGA* | |||
Physicochemical properties | |||
| Number of amino acids: | 220 | ||
| Molecular weight: | 20,928.396 | ||
| Theoretical pI: | 4.575 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11960 | ||
| Instability index: | 39.432 | ||
| aromaticity | 0.052 | ||
| GRAVY | -0.293 | ||
Secondary Structure Fraction | |||
| Helix | 0.250 | ||
| turn | 0.203 | ||
| sheet | 0.255 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343500.1 | complete | 192 | 72-650(+) |
Amino Acid sequence : | |||
| METFLFTSESVNEGHPDKLCDQISDAVLDACLAQDPESKVACETCTKTNMVMVFGEITTKADVDYEKIVRDTCRAIGFVSDDVGLDADNCKVLVNIEQQSPDIAQGVHGHLTKRPEEIGA GDQGHMFGYATDETPELMPLSHVLATKLGARLTEVRKNGTCPWLRPDGKTQVTVEYYNENGAMVPCPASTLC* | |||
Physicochemical properties | |||
| Number of amino acids: | 192 | ||
| Molecular weight: | 20,928.396 | ||
| Theoretical pI: | 4.575 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11960 | ||
| Instability index: | 39.432 | ||
| aromaticity | 0.052 | ||
| GRAVY | -0.293 | ||
Secondary Structure Fraction | |||
| Helix | 0.250 | ||
| turn | 0.203 | ||
| sheet | 0.255 | ||