Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY343502.1 | 5prime_partial | 132 | 400-2(-) |
Amino Acid sequence : | |||
GQEDINSPFISFTPICVGAQERQDATEKLIEEEGDMMIVIGGGNSSNTSSLQVIPEEGGIPSYWGAPPERIGLGNRIVPKLAHGELVEKEEWIPKGPVPVGIWVGPSPPHKVIEAIIVKV FQIKIDQESYPL* | |||
Physicochemical properties | |||
Number of amino acids: | 132 | ||
Molecular weight: | 14,323.180 | ||
Theoretical pI: | 4.609 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19480 19480 | ||
Instability index: | 52.486 | ||
aromaticity | 0.061 | ||
GRAVY | -0.170 | ||
Secondary Structure Fraction | |||
Helix | 0.318 | ||
turn | 0.318 | ||
sheet | 0.212 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY343502.1 | 5prime_partial | 132 | 400-2(-) |
Amino Acid sequence : | |||
GQEDINSPFISFTPICVGAQERQDATEKLIEEEGDMMIVIGGGNSSNTSSLQVIPEEGGIPSYWGAPPERIGLGNRIVPKLAHGELVEKEEWIPKGPVPVGIWVGPSPPHKVIEAIIVKV FQIKIDQESYPL* | |||
Physicochemical properties | |||
Number of amino acids: | 132 | ||
Molecular weight: | 14,323.180 | ||
Theoretical pI: | 4.609 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19480 19480 | ||
Instability index: | 52.486 | ||
aromaticity | 0.061 | ||
GRAVY | -0.170 | ||
Secondary Structure Fraction | |||
Helix | 0.318 | ||
turn | 0.318 | ||
sheet | 0.212 |