| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343504.1 | internal | 241 | 1-723(+) |
Amino Acid sequence : | |||
| PLFLTSNPALLAQPMALQVEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLISCRTEFGPSQPFKGARITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAV FAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYEKTGKLPDPSSTDNAEFQIVLTLIRDGLKANPTKYRKMKERLVGVSEETTTGVKRLYQMQANGTPAFPC H | |||
Physicochemical properties | |||
| Number of amino acids: | 241 | ||
| Molecular weight: | 23,683.534 | ||
| Theoretical pI: | 5.366 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 41.955 | ||
| aromaticity | 0.013 | ||
| GRAVY | 0.070 | ||
Secondary Structure Fraction | |||
| Helix | 0.299 | ||
| turn | 0.299 | ||
| sheet | 0.346 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343504.1 | complete | 231 | 723-28(-) |
Amino Acid sequence : | |||
| MAGKSRSAISLHLIQPLHTSSCFLRNTNQSLLHLPILGGIGLQPISDQRQHYLKLRIIGRAGVRQLPRLLVLLLRLHALVDQQSGITAVVHDEIGAAARAPIEGPLGAPPVLLQGLTLPG EDGGAVASNGSGGVVLSGEDVARAPSDLSAESGKGLDEDGSLDGHVETSGDPGTLEGLGGAELGPAGNEARHLHLGELDFEAAEVGLGHVLDLVLAAGGGLLHLERHGLSE* | |||
Physicochemical properties | |||
| Number of amino acids: | 231 | ||
| Molecular weight: | 23,683.534 | ||
| Theoretical pI: | 5.366 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 41.955 | ||
| aromaticity | 0.013 | ||
| GRAVY | 0.070 | ||
Secondary Structure Fraction | |||
| Helix | 0.299 | ||
| turn | 0.299 | ||
| sheet | 0.346 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343504.1 | internal | 241 | 1-723(+) |
Amino Acid sequence : | |||
| PLFLTSNPALLAQPMALQVEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLISCRTEFGPSQPFKGARITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAV FAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYEKTGKLPDPSSTDNAEFQIVLTLIRDGLKANPTKYRKMKERLVGVSEETTTGVKRLYQMQANGTPAFPC H | |||
Physicochemical properties | |||
| Number of amino acids: | 241 | ||
| Molecular weight: | 23,683.534 | ||
| Theoretical pI: | 5.366 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 41.955 | ||
| aromaticity | 0.013 | ||
| GRAVY | 0.070 | ||
Secondary Structure Fraction | |||
| Helix | 0.299 | ||
| turn | 0.299 | ||
| sheet | 0.346 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343504.1 | complete | 231 | 723-28(-) |
Amino Acid sequence : | |||
| MAGKSRSAISLHLIQPLHTSSCFLRNTNQSLLHLPILGGIGLQPISDQRQHYLKLRIIGRAGVRQLPRLLVLLLRLHALVDQQSGITAVVHDEIGAAARAPIEGPLGAPPVLLQGLTLPG EDGGAVASNGSGGVVLSGEDVARAPSDLSAESGKGLDEDGSLDGHVETSGDPGTLEGLGGAELGPAGNEARHLHLGELDFEAAEVGLGHVLDLVLAAGGGLLHLERHGLSE* | |||
Physicochemical properties | |||
| Number of amino acids: | 231 | ||
| Molecular weight: | 23,683.534 | ||
| Theoretical pI: | 5.366 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 41.955 | ||
| aromaticity | 0.013 | ||
| GRAVY | 0.070 | ||
Secondary Structure Fraction | |||
| Helix | 0.299 | ||
| turn | 0.299 | ||
| sheet | 0.346 | ||