| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343530.1 | complete | 225 | 14-691(+) |
Amino Acid sequence : | |||
| MEVTPKTLADVKGGTLISYEGKVQLLEIAQVPDEHVNEFKSIEKFKIFNTNNLWVNLQAIDRLVQADALKMEIIPNPKEVDGIKVLQLETAAGAAIKFFDHAIGANVPRSRFLPVKATSD LLLVQSDLYTLNDGFVTRNPARANPSNPSIDLGPEFKKVSNFLSRFKSIPSIIELDSLKVTGDVWFGAGVVLKGKVTIAAKSGVKLEIPDGKVIADKEINGPEDI* | |||
Physicochemical properties | |||
| Number of amino acids: | 225 | ||
| Molecular weight: | 13,296.587 | ||
| Theoretical pI: | 9.392 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3105 | ||
| Instability index: | 44.271 | ||
| aromaticity | 0.073 | ||
| GRAVY | 0.420 | ||
Secondary Structure Fraction | |||
| Helix | 0.350 | ||
| turn | 0.301 | ||
| sheet | 0.285 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343530.1 | 5prime_partial | 123 | 768-397(-) |
Amino Acid sequence : | |||
| CLINPLHITNRITSHCIELLAYIRLLYMSSGPLISLSAITFPSGISSFTPDLAAIVTLPFKTTPAPNQTSPVTFKLSSSMMLGMDLNLLKKLETFLNSGPRSIEGLEGLALAGFRVTKPS FKV* | |||
Physicochemical properties | |||
| Number of amino acids: | 123 | ||
| Molecular weight: | 13,296.587 | ||
| Theoretical pI: | 9.392 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3105 | ||
| Instability index: | 44.271 | ||
| aromaticity | 0.073 | ||
| GRAVY | 0.420 | ||
Secondary Structure Fraction | |||
| Helix | 0.350 | ||
| turn | 0.301 | ||
| sheet | 0.285 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343530.1 | complete | 225 | 14-691(+) |
Amino Acid sequence : | |||
| MEVTPKTLADVKGGTLISYEGKVQLLEIAQVPDEHVNEFKSIEKFKIFNTNNLWVNLQAIDRLVQADALKMEIIPNPKEVDGIKVLQLETAAGAAIKFFDHAIGANVPRSRFLPVKATSD LLLVQSDLYTLNDGFVTRNPARANPSNPSIDLGPEFKKVSNFLSRFKSIPSIIELDSLKVTGDVWFGAGVVLKGKVTIAAKSGVKLEIPDGKVIADKEINGPEDI* | |||
Physicochemical properties | |||
| Number of amino acids: | 225 | ||
| Molecular weight: | 13,296.587 | ||
| Theoretical pI: | 9.392 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3105 | ||
| Instability index: | 44.271 | ||
| aromaticity | 0.073 | ||
| GRAVY | 0.420 | ||
Secondary Structure Fraction | |||
| Helix | 0.350 | ||
| turn | 0.301 | ||
| sheet | 0.285 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343530.1 | 5prime_partial | 123 | 768-397(-) |
Amino Acid sequence : | |||
| CLINPLHITNRITSHCIELLAYIRLLYMSSGPLISLSAITFPSGISSFTPDLAAIVTLPFKTTPAPNQTSPVTFKLSSSMMLGMDLNLLKKLETFLNSGPRSIEGLEGLALAGFRVTKPS FKV* | |||
Physicochemical properties | |||
| Number of amino acids: | 123 | ||
| Molecular weight: | 13,296.587 | ||
| Theoretical pI: | 9.392 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3105 | ||
| Instability index: | 44.271 | ||
| aromaticity | 0.073 | ||
| GRAVY | 0.420 | ||
Secondary Structure Fraction | |||
| Helix | 0.350 | ||
| turn | 0.301 | ||
| sheet | 0.285 | ||