| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343541.1 | 3prime_partial | 190 | 128-697(+) |
Amino Acid sequence : | |||
| MIVFYCIPVTPGYSRLIYAGARNFAVQIDRFVPRWITHMSHNLIFDSDLFLLHVEEQKLKDLDWHKSCYIPTKADGQVVAFRRWLNKYGGTQVDWRNNFTPALPPTPSREQLFDRYWSHT AECSSCSVACKRLNALEIGLQAMSLVFVAMAAAVSAPATRYSMVAMAVLSFLASKWLSHFIPKTFYNHGY | |||
Physicochemical properties | |||
| Number of amino acids: | 190 | ||
| Molecular weight: | 21,776.986 | ||
| Theoretical pI: | 9.145 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 46410 46660 | ||
| Instability index: | 55.679 | ||
| aromaticity | 0.142 | ||
| GRAVY | 0.038 | ||
Secondary Structure Fraction | |||
| Helix | 0.353 | ||
| turn | 0.205 | ||
| sheet | 0.247 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343541.1 | 3prime_partial | 190 | 128-697(+) |
Amino Acid sequence : | |||
| MIVFYCIPVTPGYSRLIYAGARNFAVQIDRFVPRWITHMSHNLIFDSDLFLLHVEEQKLKDLDWHKSCYIPTKADGQVVAFRRWLNKYGGTQVDWRNNFTPALPPTPSREQLFDRYWSHT AECSSCSVACKRLNALEIGLQAMSLVFVAMAAAVSAPATRYSMVAMAVLSFLASKWLSHFIPKTFYNHGY | |||
Physicochemical properties | |||
| Number of amino acids: | 190 | ||
| Molecular weight: | 21,776.986 | ||
| Theoretical pI: | 9.145 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 46410 46660 | ||
| Instability index: | 55.679 | ||
| aromaticity | 0.142 | ||
| GRAVY | 0.038 | ||
Secondary Structure Fraction | |||
| Helix | 0.353 | ||
| turn | 0.205 | ||
| sheet | 0.247 | ||