| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343545.1 | internal | 245 | 3-737(+) |
Amino Acid sequence : | |||
| RSSALPNTVMPKSVLYLLTDDKSGVNVGVNVGGHGHDKDKDHDHDKDHGESHKNHKPVNVHVAPFNYHYAATETQLHDSPNVALFFLEKDLYAGNKMTLQFSKDTNQQKFLPRQVADSIP FSSDKLPEIYTKFSVEPDSDEAEAMKKTIEECEEKGIKGEEKVCATSLESMVDFATSKIGNNVEAVSTEAHSSERKVYRIEGVSRKPSNKPVVVCHQQEYEYAVFYCHKTETTVAYDVSL VGAGG | |||
Physicochemical properties | |||
| Number of amino acids: | 245 | ||
| Molecular weight: | 12,797.871 | ||
| Theoretical pI: | 10.238 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3105 | ||
| Instability index: | 50.239 | ||
| aromaticity | 0.099 | ||
| GRAVY | 0.201 | ||
Secondary Structure Fraction | |||
| Helix | 0.405 | ||
| turn | 0.180 | ||
| sheet | 0.252 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343545.1 | 5prime_partial | 111 | 737-402(-) |
Amino Acid sequence : | |||
| PAGPHERNIVGHRRLSLVAVKHSILILLLVAHDHRLVTRLPRHSLDTVHFPLRTMRFCRHCFDVVPYFRRGEIDHGLQRSSTDLLLPFYALFLAFFDGFLHGLGLVGIRLD* | |||
Physicochemical properties | |||
| Number of amino acids: | 111 | ||
| Molecular weight: | 12,797.871 | ||
| Theoretical pI: | 10.238 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3105 | ||
| Instability index: | 50.239 | ||
| aromaticity | 0.099 | ||
| GRAVY | 0.201 | ||
Secondary Structure Fraction | |||
| Helix | 0.405 | ||
| turn | 0.180 | ||
| sheet | 0.252 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343545.1 | internal | 245 | 3-737(+) |
Amino Acid sequence : | |||
| RSSALPNTVMPKSVLYLLTDDKSGVNVGVNVGGHGHDKDKDHDHDKDHGESHKNHKPVNVHVAPFNYHYAATETQLHDSPNVALFFLEKDLYAGNKMTLQFSKDTNQQKFLPRQVADSIP FSSDKLPEIYTKFSVEPDSDEAEAMKKTIEECEEKGIKGEEKVCATSLESMVDFATSKIGNNVEAVSTEAHSSERKVYRIEGVSRKPSNKPVVVCHQQEYEYAVFYCHKTETTVAYDVSL VGAGG | |||
Physicochemical properties | |||
| Number of amino acids: | 245 | ||
| Molecular weight: | 12,797.871 | ||
| Theoretical pI: | 10.238 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3105 | ||
| Instability index: | 50.239 | ||
| aromaticity | 0.099 | ||
| GRAVY | 0.201 | ||
Secondary Structure Fraction | |||
| Helix | 0.405 | ||
| turn | 0.180 | ||
| sheet | 0.252 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343545.1 | 5prime_partial | 111 | 737-402(-) |
Amino Acid sequence : | |||
| PAGPHERNIVGHRRLSLVAVKHSILILLLVAHDHRLVTRLPRHSLDTVHFPLRTMRFCRHCFDVVPYFRRGEIDHGLQRSSTDLLLPFYALFLAFFDGFLHGLGLVGIRLD* | |||
Physicochemical properties | |||
| Number of amino acids: | 111 | ||
| Molecular weight: | 12,797.871 | ||
| Theoretical pI: | 10.238 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3105 | ||
| Instability index: | 50.239 | ||
| aromaticity | 0.099 | ||
| GRAVY | 0.201 | ||
Secondary Structure Fraction | |||
| Helix | 0.405 | ||
| turn | 0.180 | ||
| sheet | 0.252 | ||