Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY343545.1 | internal | 245 | 3-737(+) |
Amino Acid sequence : | |||
RSSALPNTVMPKSVLYLLTDDKSGVNVGVNVGGHGHDKDKDHDHDKDHGESHKNHKPVNVHVAPFNYHYAATETQLHDSPNVALFFLEKDLYAGNKMTLQFSKDTNQQKFLPRQVADSIP FSSDKLPEIYTKFSVEPDSDEAEAMKKTIEECEEKGIKGEEKVCATSLESMVDFATSKIGNNVEAVSTEAHSSERKVYRIEGVSRKPSNKPVVVCHQQEYEYAVFYCHKTETTVAYDVSL VGAGG | |||
Physicochemical properties | |||
Number of amino acids: | 245 | ||
Molecular weight: | 12,797.871 | ||
Theoretical pI: | 10.238 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3105 | ||
Instability index: | 50.239 | ||
aromaticity | 0.099 | ||
GRAVY | 0.201 | ||
Secondary Structure Fraction | |||
Helix | 0.405 | ||
turn | 0.180 | ||
sheet | 0.252 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY343545.1 | 5prime_partial | 111 | 737-402(-) |
Amino Acid sequence : | |||
PAGPHERNIVGHRRLSLVAVKHSILILLLVAHDHRLVTRLPRHSLDTVHFPLRTMRFCRHCFDVVPYFRRGEIDHGLQRSSTDLLLPFYALFLAFFDGFLHGLGLVGIRLD* | |||
Physicochemical properties | |||
Number of amino acids: | 111 | ||
Molecular weight: | 12,797.871 | ||
Theoretical pI: | 10.238 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3105 | ||
Instability index: | 50.239 | ||
aromaticity | 0.099 | ||
GRAVY | 0.201 | ||
Secondary Structure Fraction | |||
Helix | 0.405 | ||
turn | 0.180 | ||
sheet | 0.252 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY343545.1 | internal | 245 | 3-737(+) |
Amino Acid sequence : | |||
RSSALPNTVMPKSVLYLLTDDKSGVNVGVNVGGHGHDKDKDHDHDKDHGESHKNHKPVNVHVAPFNYHYAATETQLHDSPNVALFFLEKDLYAGNKMTLQFSKDTNQQKFLPRQVADSIP FSSDKLPEIYTKFSVEPDSDEAEAMKKTIEECEEKGIKGEEKVCATSLESMVDFATSKIGNNVEAVSTEAHSSERKVYRIEGVSRKPSNKPVVVCHQQEYEYAVFYCHKTETTVAYDVSL VGAGG | |||
Physicochemical properties | |||
Number of amino acids: | 245 | ||
Molecular weight: | 12,797.871 | ||
Theoretical pI: | 10.238 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3105 | ||
Instability index: | 50.239 | ||
aromaticity | 0.099 | ||
GRAVY | 0.201 | ||
Secondary Structure Fraction | |||
Helix | 0.405 | ||
turn | 0.180 | ||
sheet | 0.252 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY343545.1 | 5prime_partial | 111 | 737-402(-) |
Amino Acid sequence : | |||
PAGPHERNIVGHRRLSLVAVKHSILILLLVAHDHRLVTRLPRHSLDTVHFPLRTMRFCRHCFDVVPYFRRGEIDHGLQRSSTDLLLPFYALFLAFFDGFLHGLGLVGIRLD* | |||
Physicochemical properties | |||
Number of amino acids: | 111 | ||
Molecular weight: | 12,797.871 | ||
Theoretical pI: | 10.238 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3105 | ||
Instability index: | 50.239 | ||
aromaticity | 0.099 | ||
GRAVY | 0.201 | ||
Secondary Structure Fraction | |||
Helix | 0.405 | ||
turn | 0.180 | ||
sheet | 0.252 |