| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343547.1 | internal | 264 | 3-794(+) |
Amino Acid sequence : | |||
| VGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM QIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF AGKQLEDGKTLADYNIQKESTLHL | |||
Physicochemical properties | |||
| Number of amino acids: | 264 | ||
| Molecular weight: | 17,736.444 | ||
| Theoretical pI: | 7.227 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14230 | ||
| Instability index: | 62.319 | ||
| aromaticity | 0.051 | ||
| GRAVY | 0.071 | ||
Secondary Structure Fraction | |||
| Helix | 0.397 | ||
| turn | 0.218 | ||
| sheet | 0.244 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343547.1 | 5prime_partial | 156 | 794-324(-) |
Amino Acid sequence : | |||
| KVEGGLLLDVVVSKGLSILQLLPSKDQPLLVRWDSFLILNLSLHIVYRIRTLHLQCDGLPRQCLHKYLHSSSQPQHQVQSRLLLDVVIRQCTPIFQLLPSEDQPLLIRWNTLLVLNLGLH IVNCVRALNFQSDGFSCQGLHENLHTTTEPQDQVQG* | |||
Physicochemical properties | |||
| Number of amino acids: | 156 | ||
| Molecular weight: | 17,736.444 | ||
| Theoretical pI: | 7.227 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14230 | ||
| Instability index: | 62.319 | ||
| aromaticity | 0.051 | ||
| GRAVY | 0.071 | ||
Secondary Structure Fraction | |||
| Helix | 0.397 | ||
| turn | 0.218 | ||
| sheet | 0.244 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343547.1 | internal | 264 | 3-794(+) |
Amino Acid sequence : | |||
| VGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM QIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF AGKQLEDGKTLADYNIQKESTLHL | |||
Physicochemical properties | |||
| Number of amino acids: | 264 | ||
| Molecular weight: | 17,736.444 | ||
| Theoretical pI: | 7.227 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14230 | ||
| Instability index: | 62.319 | ||
| aromaticity | 0.051 | ||
| GRAVY | 0.071 | ||
Secondary Structure Fraction | |||
| Helix | 0.397 | ||
| turn | 0.218 | ||
| sheet | 0.244 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343547.1 | 5prime_partial | 156 | 794-324(-) |
Amino Acid sequence : | |||
| KVEGGLLLDVVVSKGLSILQLLPSKDQPLLVRWDSFLILNLSLHIVYRIRTLHLQCDGLPRQCLHKYLHSSSQPQHQVQSRLLLDVVIRQCTPIFQLLPSEDQPLLIRWNTLLVLNLGLH IVNCVRALNFQSDGFSCQGLHENLHTTTEPQDQVQG* | |||
Physicochemical properties | |||
| Number of amino acids: | 156 | ||
| Molecular weight: | 17,736.444 | ||
| Theoretical pI: | 7.227 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14230 | ||
| Instability index: | 62.319 | ||
| aromaticity | 0.051 | ||
| GRAVY | 0.071 | ||
Secondary Structure Fraction | |||
| Helix | 0.397 | ||
| turn | 0.218 | ||
| sheet | 0.244 | ||