| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343552.1 | internal | 229 | 1-687(+) |
Amino Acid sequence : | |||
| PLSSSQQHTRQQFSHMAMASSLPSPLTIKTSLKQPDVKLPGVGPCAARSLPLPSLKFTARPSSSSVPVVVAAATSMVGAETQAGAATPAKVLPFRVGHGFDLHRLEPGYPLIIGGINIPH DRGCEAHSDGDVLLHCVVDAILGALGLPDIGQIFPDTDPKWKGAPSSVFMEEAVRLMHEAGYELGNLDATLILQRPKVSPHKEAIRANLCKLLGADPSVVNLKAKTHEK | |||
Physicochemical properties | |||
| Number of amino acids: | 229 | ||
| Molecular weight: | 24,215.715 | ||
| Theoretical pI: | 8.508 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8730 | ||
| Instability index: | 42.129 | ||
| aromaticity | 0.039 | ||
| GRAVY | -0.041 | ||
Secondary Structure Fraction | |||
| Helix | 0.271 | ||
| turn | 0.279 | ||
| sheet | 0.279 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343552.1 | internal | 229 | 1-687(+) |
Amino Acid sequence : | |||
| PLSSSQQHTRQQFSHMAMASSLPSPLTIKTSLKQPDVKLPGVGPCAARSLPLPSLKFTARPSSSSVPVVVAAATSMVGAETQAGAATPAKVLPFRVGHGFDLHRLEPGYPLIIGGINIPH DRGCEAHSDGDVLLHCVVDAILGALGLPDIGQIFPDTDPKWKGAPSSVFMEEAVRLMHEAGYELGNLDATLILQRPKVSPHKEAIRANLCKLLGADPSVVNLKAKTHEK | |||
Physicochemical properties | |||
| Number of amino acids: | 229 | ||
| Molecular weight: | 24,215.715 | ||
| Theoretical pI: | 8.508 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8730 | ||
| Instability index: | 42.129 | ||
| aromaticity | 0.039 | ||
| GRAVY | -0.041 | ||
Secondary Structure Fraction | |||
| Helix | 0.271 | ||
| turn | 0.279 | ||
| sheet | 0.279 | ||