| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343553.1 | 5prime_partial | 149 | 457-8(-) |
Amino Acid sequence : | |||
| GFDLHLLEPGYPLIIGGINIPHDRGCEAHSDGDVLLHCVVDAILGALGLPDIGQIFPDTDPKWKGAPSSVFMEEAVRLMHEAGYELGNLDATLILQRPKVSPHKEAIRANLCKVLGADPF VVNLKAKTHEKVDSLGENRSIAAHPPPPL* | |||
Physicochemical properties | |||
| Number of amino acids: | 149 | ||
| Molecular weight: | 16,030.267 | ||
| Theoretical pI: | 5.521 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8605 | ||
| Instability index: | 33.605 | ||
| aromaticity | 0.047 | ||
| GRAVY | -0.048 | ||
Secondary Structure Fraction | |||
| Helix | 0.309 | ||
| turn | 0.262 | ||
| sheet | 0.289 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343553.1 | 5prime_partial | 149 | 457-8(-) |
Amino Acid sequence : | |||
| GFDLHLLEPGYPLIIGGINIPHDRGCEAHSDGDVLLHCVVDAILGALGLPDIGQIFPDTDPKWKGAPSSVFMEEAVRLMHEAGYELGNLDATLILQRPKVSPHKEAIRANLCKVLGADPF VVNLKAKTHEKVDSLGENRSIAAHPPPPL* | |||
Physicochemical properties | |||
| Number of amino acids: | 149 | ||
| Molecular weight: | 16,030.267 | ||
| Theoretical pI: | 5.521 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8605 | ||
| Instability index: | 33.605 | ||
| aromaticity | 0.047 | ||
| GRAVY | -0.048 | ||
Secondary Structure Fraction | |||
| Helix | 0.309 | ||
| turn | 0.262 | ||
| sheet | 0.289 | ||