Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY343561.1 | 3prime_partial | 255 | 41-805(+) |
Amino Acid sequence : | |||
MAPAALVSNGDYAAVKAPVTGRLASVYSEVQNSRLEHSLPLPSVLKSSFKVVDGPPSSAAGNPDEIAKLFPCLFGQPSASLVPGDSAGALSSQALKIGVVLSGGQAPGGHNVISGIFDYL QDHCKGSTLYGFRGGPAGIMKGKYVVLTPEYIYPYRNQGGFDMICSGRDKIETPEQFKQAEETAVKLDLDGIVVIGGDDSNTNACLLAXNFRSKNLKTRVIGCPKTIDGDLKSKEVPISF GFDTACKIYAEMIGN | |||
Physicochemical properties | |||
Number of amino acids: | 255 | ||
Molecular weight: | 10,785.713 | ||
Theoretical pI: | 10.454 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7115 | ||
Instability index: | 64.515 | ||
aromaticity | 0.101 | ||
GRAVY | 0.683 | ||
Secondary Structure Fraction | |||
Helix | 0.394 | ||
turn | 0.333 | ||
sheet | 0.232 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY343561.1 | 5prime_partial | 100 | 804-502(-) |
Amino Acid sequence : | |||
LPIISAYILHAVSNPKLMGTSLLFRSPSMVFGHPITLVFKFLLLKXSARRHAFVFESSPPITTIPSRSSFTAVSSACLNCSGVSILSLPLQIISNPPWFL* | |||
Physicochemical properties | |||
Number of amino acids: | 100 | ||
Molecular weight: | 10,785.713 | ||
Theoretical pI: | 10.454 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7115 | ||
Instability index: | 64.515 | ||
aromaticity | 0.101 | ||
GRAVY | 0.683 | ||
Secondary Structure Fraction | |||
Helix | 0.394 | ||
turn | 0.333 | ||
sheet | 0.232 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY343561.1 | 3prime_partial | 255 | 41-805(+) |
Amino Acid sequence : | |||
MAPAALVSNGDYAAVKAPVTGRLASVYSEVQNSRLEHSLPLPSVLKSSFKVVDGPPSSAAGNPDEIAKLFPCLFGQPSASLVPGDSAGALSSQALKIGVVLSGGQAPGGHNVISGIFDYL QDHCKGSTLYGFRGGPAGIMKGKYVVLTPEYIYPYRNQGGFDMICSGRDKIETPEQFKQAEETAVKLDLDGIVVIGGDDSNTNACLLAXNFRSKNLKTRVIGCPKTIDGDLKSKEVPISF GFDTACKIYAEMIGN | |||
Physicochemical properties | |||
Number of amino acids: | 255 | ||
Molecular weight: | 10,785.713 | ||
Theoretical pI: | 10.454 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7115 | ||
Instability index: | 64.515 | ||
aromaticity | 0.101 | ||
GRAVY | 0.683 | ||
Secondary Structure Fraction | |||
Helix | 0.394 | ||
turn | 0.333 | ||
sheet | 0.232 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY343561.1 | 5prime_partial | 100 | 804-502(-) |
Amino Acid sequence : | |||
LPIISAYILHAVSNPKLMGTSLLFRSPSMVFGHPITLVFKFLLLKXSARRHAFVFESSPPITTIPSRSSFTAVSSACLNCSGVSILSLPLQIISNPPWFL* | |||
Physicochemical properties | |||
Number of amino acids: | 100 | ||
Molecular weight: | 10,785.713 | ||
Theoretical pI: | 10.454 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7115 | ||
Instability index: | 64.515 | ||
aromaticity | 0.101 | ||
GRAVY | 0.683 | ||
Secondary Structure Fraction | |||
Helix | 0.394 | ||
turn | 0.333 | ||
sheet | 0.232 |